DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MFS3 and VHT1

DIOPT Version :9

Sequence 1:NP_608572.1 Gene:MFS3 / 33292 FlyBaseID:FBgn0031307 Length:512 Species:Drosophila melanogaster
Sequence 2:NP_011579.1 Gene:VHT1 / 852956 SGDID:S000003297 Length:593 Species:Saccharomyces cerevisiae


Alignment Length:263 Identity:55/263 - (20%)
Similarity:92/263 - (34%) Gaps:55/263 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 GYLVSQIPLAHVAENFSAKWVMLFSVAINVVCTLLTPV-------FTELHY-----GGLILMRVL 169
            |.:|.|:|..::...|.:.              ::.||       ||...|     ..|...|.:
Yeast   176 GAIVFQLPFMYLLPRFPSH--------------IILPVMDLGWTWFTFACYRANSLAELRAYRFI 226

  Fly   170 EGVGGGASFPAMHVMIASWAPPTERMVMSTIIYVGTSAGTALSILLA--------GVCSAQWGWE 226
            ....|.|.:|....::..|..|.|......:.:.|...|:..|.||.        ||.... ||.
Yeast   227 LSAFGAAYYPVSQYILGCWYAPDEINSRVCLFFCGQQLGSVTSGLLQSRIFKSLNGVHGLA-GWR 290

  Fly   227 SVFYVMG-ALSCIWMLLWVILVQDNPNK--QRFISLEE---------RQMITSSLGTEQKTEHHP 279
            .:|.:.. |:|....::...::...|:|  ..|::.||         |..|...:...:......
Yeast   291 WMFLIDAIAISLPTAIIGFFVIPGVPSKCYSLFLTDEEIRIARARNKRNQIKDGVDKSKLAPLWS 355

  Fly   280 AVPWGKVFTSVPFWAILIAHTCSNFGWYMFLIEIPFYMKQVLKFNVASNAALSALPYFPMIIFSI 344
            ...|.|||.:..||.:::..|||......:......::|...|:::|....||.:|        .
Yeast   356 RKLWKKVFCTPAFWVLVVFDTCSWNNMTAYSGSYTLWLKSNTKYSIAQVNNLSVIP--------A 412

  Fly   345 CLG 347
            |||
Yeast   413 CLG 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MFS3NP_608572.1 2A0114euk 19..489 CDD:129972 55/263 (21%)
MFS 100..479 CDD:119392 55/263 (21%)
VHT1NP_011579.1 MFS_FEN2_like 124..542 CDD:340885 55/263 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.