DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MFS3 and PHT4;2

DIOPT Version :9

Sequence 1:NP_608572.1 Gene:MFS3 / 33292 FlyBaseID:FBgn0031307 Length:512 Species:Drosophila melanogaster
Sequence 2:NP_001325125.1 Gene:PHT4;2 / 818384 AraportID:AT2G38060 Length:561 Species:Arabidopsis thaliana


Alignment Length:400 Identity:109/400 - (27%)
Similarity:175/400 - (43%) Gaps:33/400 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 NHTAIKAHGDGGGHGGHGS---------------VILSNASQVSLVEECNPPGGASNVTAKVEDG 98
            |.:..:...:|...||.||               |::..|..:.|   ||    |..|...|...
plant    67 NQSPERCAAEGVLTGGGGSEAIAEVRTMMPERIKVVILTACMMCL---CN----ADRVVMSVAVV 124

  Fly    99 P----FDWSEPLQGTLLSCYFWGYLVSQIPLAHVAENFSAKWVMLFSVAINVVCTLLTPVFTELH 159
            |    ..||....|.:.|.:.|||:.|.:....:.:.:..|.|:.:.||:..:.|||||......
plant   125 PLADKLGWSSSFLGVVQSSFLWGYIFSSVIGGALVDRYGGKRVLAWGVALWSLATLLTPWAAAHS 189

  Fly   160 YGGLILMRVLEGVGGGASFPAMHVMIASWAPPTERMVMSTIIYVGTSAGTALSILLAGVCSAQWG 224
            ...|:.:|...|:..|.:.|:|..:::.|.|..||.....|...|...|..:.:||..:..:..|
plant   190 TLALLCVRAFFGLAEGVAMPSMTTLLSRWFPMDERASAVGISMAGFHMGNVVGLLLTPLMLSSIG 254

  Fly   225 WESVFYVMGALSCIWMLLWVILVQDNPNKQRFISLEERQMITSSLGTEQKT---EHHPAVPWGKV 286
            ....|.:..:|..:|:..|...|.:||....||:..|.::|.:....:..|   :.:|::  ..:
plant   255 ISGPFILFASLGLLWVSTWSSGVTNNPQDSPFITRSELRLIQAGKPVQPSTISPKPNPSL--RLL 317

  Fly   287 FTSVPFWAILIAHTCSNFGWYMFLIEIPFYMKQVLKFNVASNAALSALPYFPMIIFSICLGKLLD 351
            .:.:|.|||:.|:..:|:|:::.|..:|.|.:.|...|:...|..||||:..|.|.....|...|
plant   318 LSKLPTWAIIFANVTNNWGYFVLLSWMPVYFQTVFNVNLKQAAWFSALPWATMAISGYYAGAASD 382

  Fly   352 SLQAKGKITTTVARKTATSICTLIPGVCLLVLCYIGCRHYEAVSVMSVGIVAMGSMFSGFLSNHI 416
            .|...|...|:| ||...||..:.||:.||.|.:.......|| .|::.:.......:|||.|..
plant   383 FLIRTGHSVTSV-RKIMQSIGFMGPGLSLLCLNFAKSPSCAAV-FMTIALSLSSFSQAGFLLNMQ 445

  Fly   417 DIAPNFAGTL 426
            ||||.:||.|
plant   446 DIAPQYAGFL 455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MFS3NP_608572.1 2A0114euk 19..489 CDD:129972 108/399 (27%)
MFS 100..479 CDD:119392 93/329 (28%)
PHT4;2NP_001325125.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2532
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53923
OrthoDB 1 1.010 - - D497052at2759
OrthoFinder 1 1.000 - - FOG0000034
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11662
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.930

Return to query results.
Submit another query.