DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MFS3 and SLC17A9

DIOPT Version :9

Sequence 1:NP_608572.1 Gene:MFS3 / 33292 FlyBaseID:FBgn0031307 Length:512 Species:Drosophila melanogaster
Sequence 2:NP_071365.4 Gene:SLC17A9 / 63910 HGNCID:16192 Length:436 Species:Homo sapiens


Alignment Length:406 Identity:106/406 - (26%)
Similarity:184/406 - (45%) Gaps:35/406 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 FDWSEPLQGTLLSCYFWGYLVSQIPLAHVAENFSAKWVMLFSVAINVVCTLLTPVFTEL---HYG 161
            |.|::...|.:||.:||||.::|:...|:.:....:.|:|.|.:.....|.:||:...|   |..
Human    55 FGWNKKEAGIVLSSFFWGYCLTQVVGGHLGDRIGGEKVILLSASAWGSITAVTPLLAHLSSAHLA 119

  Fly   162 GLILMRVLEGVGGGASFPAMHVMIASWAPPTERMVMSTIIYVGTSAGTALSILLAGVCSAQWGWE 226
            .:...|:|.|:..|..|||:..:::.....:||....:|:..|:..||.|:..:..:....:||:
Human   120 FMTFSRILMGLLQGVYFPALTSLLSQKVRESERAFTYSIVGAGSQFGTLLTGAVGSLLLEWYGWQ 184

  Fly   227 SVFYVMGALSCIWMLLWVILVQDNPNKQRFISLEERQMITS--SLGTEQKTEHHPAVPWGKVFTS 289
            |:||..|.|:.:|  :|.:        .|:: |.|:.:|.:  .|...:....|..|||.::|..
Human   185 SIFYFSGGLTLLW--VWYV--------YRYL-LSEKDLILALGVLAQSRPVSRHNRVPWRRLFRK 238

  Fly   290 VPFWAILIAHTCSNFGWYMFLIEIPFYMKQVLKFNVASNAALSALPYFPMIIFSICLGKLLDSLQ 354
            ...||.:::...:...:::.|..:|.:.::.  |..|.....:.:|:...|..|:..|.|.|.|.
Human   239 PAVWAAVVSQLSAACSFFILLSWLPTFFEET--FPDAKGWIFNVVPWLVAIPASLFSGFLSDHLI 301

  Fly   355 AKGKITTTVARKTATSICTLIPGVCLLVLCYIG--CRHYEAVSVMSVGIVAMGSMFSGFLSNHID 417
            .:|....|| ||....:...:..|..|.|.:..  |   |:|...|..|.......||...|..|
Human   302 NQGYRAITV-RKLMQGMGLGLSSVFALCLGHTSSFC---ESVVFASASIGLQTFNHSGISVNIQD 362

  Fly   418 IAPNFAGTLVALTNTAATLPGIVVPLFVGFVTKGNQNIGAWRIIFGVTIVLFAL---EFLVFVFL 479
            :||:.||.|..:.|||..|.|:|.....|::.   :..|:|..:|.:..::..|   .||||   
Human   363 LAPSCAGFLFGVANTAGALAGVVGVCLGGYLM---ETTGSWTCLFNLVAIISNLGLCTFLVF--- 421

  Fly   480 GSGSEQPWNKAGTPKD 495
              |..|..:.:.|.:|
Human   422 --GQAQRVDLSSTHED 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MFS3NP_608572.1 2A0114euk 19..489 CDD:129972 104/398 (26%)
MFS 100..479 CDD:119392 102/388 (26%)
SLC17A9NP_071365.4 MFS_1 44..386 CDD:311564 92/347 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2532
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53923
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.