DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MFS3 and SLC17A2

DIOPT Version :9

Sequence 1:NP_608572.1 Gene:MFS3 / 33292 FlyBaseID:FBgn0031307 Length:512 Species:Drosophila melanogaster
Sequence 2:NP_001273052.1 Gene:SLC17A2 / 10246 HGNCID:10930 Length:478 Species:Homo sapiens


Alignment Length:482 Identity:135/482 - (28%)
Similarity:236/482 - (48%) Gaps:32/482 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 RYVLALLGSIGMAIVYGLKVNLSVAMVAMVNHTAIKAHGDGGGHGGHGSVILSNASQVSLVEECN 83
            ||.|||:.......:...:|:||:|::||||.|..:.              |||||....|.:. 
Human    17 RYGLALIMHFSNFTMITQRVSLSIAIIAMVNTTQQQG--------------LSNASTEGPVADA- 66

  Fly    84 PPGGASNVTAKVED---GPFDWSEPLQGTLLSCYFWGYLVSQIPLAHVAENFSAKWVMLFSVAIN 145
              ...|:::.|..|   ..:.||...||.:.|...:|.:::.||..::|..|.||.::...:.|:
Human    67 --FNNSSISIKEFDTKASVYQWSPETQGIIFSSINYGIILTLIPSGYLAGIFGAKKMLGAGLLIS 129

  Fly   146 VVCTLLTPVFTELHYGGLILMRVLEGVGGGASFPAMHVMIASWAPPTERMVMSTIIYVGTSAGTA 210
            .:.||.||:..:.....:|::|.::|:..|.::.....:.|.||||.||..::||...|::.|:.
Human   130 SLLTLFTPLAADFGVILVIMVRTVQGMAQGMAWTGQFTIWAKWAPPLERSKLTTIAGSGSAFGSF 194

  Fly   211 LSILLAGVCSAQWGWESVFYVMGALSCIWMLLWVILVQDNPNKQRFISLEERQMITSSLGTEQKT 275
            :.:.:.|:.|....|..:||:.|:..|:..|||..::.|:|.....||:.|::.|.||| .:|.:
Human   195 IILCVGGLISQALSWPFIFYIFGSTGCVCCLLWFTVIYDDPMHHPCISVREKEHILSSL-AQQPS 258

  Fly   276 EHHPAVPWGKVFTSVPFWAILIAHTCSNFGWY--MFLIEIPFYMKQVLKFNVASNAALSALPYFP 338
            ....|||...:.|.:|.|||.:.. .|:| |.  :.|..:|.|:..:|..|:..:..||:||:..
Human   259 SPGRAVPIKAMVTCLPLWAIFLGF-FSHF-WLCTIILTYLPTYISTLLHVNIRDSGVLSSLPFIA 321

  Fly   339 MIIFSICLGKLLDSLQAKGKITTTVARKTATSICTLIPGVCLLVLCYIGCRHYEAVSVMSVGIVA 403
            ....:|..|:|.|.|.::..:.....||..:|:..|:|.:|.:.|.:: ...|....::.:.|..
Human   322 AASCTILGGQLADFLLSRNLLRLITVRKLFSSLGLLLPSICAVALPFV-ASSYVITIILLILIPG 385

  Fly   404 MGSMF-SGFLSNHIDIAPNFAGTLVALTNTAATLPGIVVPLFVGFVTKGNQNIGAWRIIF--GVT 465
            ..::. |||:.|.:||||.:|..|:.::.....:.||:.....||:...:...| ||.:|  ...
Human   386 TSNLCDSGFIINTLDIAPRYASFLMGISRGFGLIAGIISSTATGFLISQDFESG-WRNVFFLSAA 449

  Fly   466 IVLFALEFLVFVFLGSGSEQPWNKAGT 492
            :.:|.|.|  ::..|....|.|.|..|
Human   450 VNMFGLVF--YLTFGQAELQDWAKERT 474

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MFS3NP_608572.1 2A0114euk 19..489 CDD:129972 133/477 (28%)
MFS 100..479 CDD:119392 107/383 (28%)
SLC17A2NP_001273052.1 2A0114euk 1..477 CDD:129972 135/482 (28%)
MFS 81..461 CDD:119392 107/386 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2532
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D497052at2759
OrthoFinder 1 1.000 - - FOG0000034
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.