DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4629 and BRSK1

DIOPT Version :9

Sequence 1:NP_608564.3 Gene:CG4629 / 33284 FlyBaseID:FBgn0031299 Length:570 Species:Drosophila melanogaster
Sequence 2:NP_115806.1 Gene:BRSK1 / 84446 HGNCID:18994 Length:778 Species:Homo sapiens


Alignment Length:316 Identity:94/316 - (29%)
Similarity:157/316 - (49%) Gaps:42/316 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SATVKVTSAATP----PHPPPLTTTTTPLTICQPPPPTPPYQRLTKALQCDPRCGHEVTIGRRIG 64
            |:..|.....:|    |||.|            .||....|                      :|
Human     2 SSGAKEGGGGSPAYHLPHPHP------------HPPQHAQY----------------------VG 32

  Fly    65 LYRFCGDIGRGNFSKVKLAVHQLTRDKVAIKVVDLDRAGLDAKALRMLSSEIATLECVHHPNILR 129
            .||....:|:|....|||.||.:|..|||||:|  :|..|....|..:..|||.|:.:.||::|:
Human    33 PYRLEKTLGKGQTGLVKLGVHCITGQKVAIKIV--NREKLSESVLMKVEREIAILKLIEHPHVLK 95

  Fly   130 LFEVVETLGRVYLVTEWIRGGELYNHITQGGPLREIHAAPLLKQLLLAVKHMHSLGYVHRDIKAE 194
            |.:|.|....:|||.|.:.||||::::.:.|.|....|....:|::.|:...||....|||:|.|
Human    96 LHDVYENKKYLYLVLEHVSGGELFDYLVKKGRLTPKEARKFFRQIVSALDFCHSYSICHRDLKPE 160

  Fly   195 NVLLLSEDRLKLADFGFSTQLINGANQKLDTFCGSPPYAAPELFSDDHYIGAPVDVWALGILLYF 259
            |:||..::.:::||||.::  :...:..|:|.||||.||.||:...:.|.|...|:|:.|::|:.
Human   161 NLLLDEKNNIRIADFGMAS--LQVGDSLLETSCGSPHYACPEVIKGEKYDGRRADMWSCGVILFA 223

  Fly   260 MVVGNMPFRAPTIPGLKAAILKGDYLLPGQLSLPCIRLIQRILIHIPAQRPTIDDM 315
            ::||.:||....:..|...:.:|.:.:|..:...|..|::.::...|.:|.:::.:
Human   224 LLVGALPFDDDNLRQLLEKVKRGVFHMPHFIPPDCQSLLRGMIEVEPEKRLSLEQI 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4629NP_608564.3 STKc_NIM1 63..321 CDD:270977 84/253 (33%)
S_TKc 66..321 CDD:214567 83/250 (33%)
BRSK1NP_115806.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..29 9/38 (24%)
STKc_BRSK1_2 32..285 CDD:270983 84/252 (33%)
UBA_BRSK 314..367 CDD:270525
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 362..548
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 719..778
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.