DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4629 and CIPK26

DIOPT Version :9

Sequence 1:NP_608564.3 Gene:CG4629 / 33284 FlyBaseID:FBgn0031299 Length:570 Species:Drosophila melanogaster
Sequence 2:NP_850861.2 Gene:CIPK26 / 832246 AraportID:AT5G21326 Length:439 Species:Arabidopsis thaliana


Alignment Length:369 Identity:121/369 - (32%)
Similarity:195/369 - (52%) Gaps:39/369 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 IGRRIGLYRFCGDIGRGNFSKVKLAVHQLTRDKVAIKVVDLDRAGLDAKALRMLSSEIATLECVH 123
            :.||:|.|.....:|:|.|:||:.||:..|.::||:|::|.::. |..|....:..||.|::.::
plant     6 VQRRVGKYEVGKTLGQGTFAKVRCAVNTETGERVALKILDKEKV-LKHKMAEQIRREICTMKLIN 69

  Fly   124 HPNILRLFEVVETLGRVYLVTEWIRGGELYNHITQGGPLREIHAAPLLKQLLLAVKHMHSLGYVH 188
            |||::||:||:.:..::|:|.|:..||||::.|...|.|:|.:|....:||:.||.:.||.|..|
plant    70 HPNVVRLYEVLASKTKIYIVLEFGTGGELFDKIVHDGRLKEENARKYFQQLINAVDYCHSRGVYH 134

  Fly   189 RDIKAENVLLLSEDRLKLADFGFS--TQLINGANQKLDTFCGSPPYAAPELFSDDHYIGAPVDVW 251
            ||:|.||:||.::..||::|||.|  ::.:.| :..|.|.||:|.|||||:.:|..|.||..|:|
plant   135 RDLKPENLLLDAQGNLKVSDFGLSALSRQVRG-DGLLHTACGTPNYAAPEVLNDQGYDGATADLW 198

  Fly   252 ALGILLYFMVVGNMPFRAPTIPGLKAAILKGDYLLPGQLSLPCIRLIQRILIHIPAQRPTIDDML 316
            :.|::|:.::.|.:||....:..|...|:.|:|..|..||.....||.|||...|..|.||.::|
plant   199 SCGVILFVLLAGYLPFEDSNLMTLYKKIIAGEYHCPPWLSPGAKNLIVRILDPNPMTRITIPEVL 263

  Fly   317 NSQFVTCPKLSADLMQWEINQHTKPVKRSIFWVRSKSHRLRKSASLRDRYAEVVKKPAISMNTRQ 381
            ..             .|    ..|..|.::|       ..::.|:|.|  .:.|.|.:...:..:
plant   264 GD-------------AW----FKKNYKPAVF-------EEKEEANLDD--VDAVFKDSEEHHVTE 302

  Fly   382 QDEMFVQNFLQPIEMGHELLVPVSSQLKEP---QSTEQAKRPTR 422
            :.|.      ||..|....|:.:|..|...   :..|..||.||
plant   303 KKEE------QPTSMNAFELISMSRALDLGNLFEEEEGFKRETR 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4629NP_608564.3 STKc_NIM1 63..321 CDD:270977 98/259 (38%)
S_TKc 66..321 CDD:214567 97/256 (38%)
CIPK26NP_850861.2 STKc_SnRK3 12..267 CDD:271133 97/269 (36%)
CIPK_C 312..426 CDD:213380 8/29 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.