DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4629 and CIPK15

DIOPT Version :9

Sequence 1:NP_608564.3 Gene:CG4629 / 33284 FlyBaseID:FBgn0031299 Length:570 Species:Drosophila melanogaster
Sequence 2:NP_001031820.1 Gene:CIPK15 / 830556 AraportID:AT5G01810 Length:421 Species:Arabidopsis thaliana


Alignment Length:407 Identity:129/407 - (31%)
Similarity:192/407 - (47%) Gaps:45/407 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 IGRGNFSKVKLAVHQLTRDKVAIKVVDLDRAGLDAKALRMLSSEIATLECVHHPNILRLFEVVET 136
            :|:|.|:||..|.|..|.|.|||||:|.:|. |.......:..||:.:..:.||||:.|.||:.|
plant    18 LGQGTFAKVYHARHLKTGDSVAIKVIDKERI-LKVGMTEQIKREISAMRLLRHPNIVELHEVMAT 81

  Fly   137 LGRVYLVTEWIRGGELYNHITQGGPLREIHAAPLLKQLLLAVKHMHSLGYVHRDIKAENVLLLSE 201
            ..::|.|.|.::||||:|.::. |.|||..|....:||:.||...||.|..|||:|.||:||...
plant    82 KSKIYFVMEHVKGGELFNKVST-GKLREDVARKYFQQLVRAVDFCHSRGVCHRDLKPENLLLDEH 145

  Fly   202 DRLKLADFGFSTQLINGANQK--LDTFCGSPPYAAPELFSDDHYIGAPVDVWALGILLYFMVVGN 264
            ..||::|||.|. |.:...|.  |.|.||:|.|.|||:.|.:.|.|...|||:.|::|:.::.|.
plant   146 GNLKISDFGLSA-LSDSRRQDGLLHTTCGTPAYVAPEVISRNGYDGFKADVWSCGVILFVLLAGY 209

  Fly   265 MPFRAPTIPGLKAAILKGDYLLPGQLSLPCIRLIQRILIHIPAQRPTIDDMLNSQFVTCPKLSAD 329
            :|||...:..|...|.|.:...|..|:....||::|||...|..|.:.:.::.|           
plant   210 LPFRDSNLMELYKKIGKAEVKFPNWLAPGAKRLLKRILDPNPNTRVSTEKIMKS----------- 263

  Fly   330 LMQWEINQHTKPVKRSIFWVRSKSHRLRKSASLRDRYAEVVKKPAISMNTRQQDEMFVQNFLQPI 394
              .|......:.||.|:............:||     ||..||..|::|..:         :..:
plant   264 --SWFRKGLQEEVKESVEEETEVDAEAEGNAS-----AEKEKKRCINLNAFE---------IISL 312

  Fly   395 EMGHEL--LVPVSSQLKEPQ--STEQAKRPTRRYMFCG-SLKKKVTPMETEPEKQLANGGQSIGS 454
            ..|.:|  |.....:.:|.:  |..:|...|.:.:..| .||.||...|.|...::        |
plant   313 STGFDLSGLFEKGEEKEEMRFTSNREASEITEKLVEIGKDLKMKVRKKEHEWRVKM--------S 369

  Fly   455 AKINPWNVEVAEDCPLF 471
            |:......||.|..|.:
plant   370 AEATVVEAEVFEIAPSY 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4629NP_608564.3 STKc_NIM1 63..321 CDD:270977 97/250 (39%)
S_TKc 66..321 CDD:214567 97/250 (39%)
CIPK15NP_001031820.1 STKc_SnRK3 11..265 CDD:271133 97/262 (37%)
S_TKc 12..266 CDD:214567 97/263 (37%)
CIPK_C 305..413 CDD:213380 21/99 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.