DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4629 and KIN11

DIOPT Version :9

Sequence 1:NP_608564.3 Gene:CG4629 / 33284 FlyBaseID:FBgn0031299 Length:570 Species:Drosophila melanogaster
Sequence 2:NP_566843.1 Gene:KIN11 / 822566 AraportID:AT3G29160 Length:512 Species:Arabidopsis thaliana


Alignment Length:379 Identity:121/379 - (31%)
Similarity:185/379 - (48%) Gaps:61/379 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 YRFCGDIGRGNFSKVKLAVHQLTRDKVAIKVVD---LDRAGLDAKALRMLSSEIATLECVHHPNI 127
            |:....:|.|:|.|||:|.|.:|..|||||:::   :....::.|..|    ||..|....||:|
plant    20 YKLGKTLGIGSFGKVKIAEHVVTGHKVAIKILNRRKIKNMEMEEKVRR----EIKILRLFMHPHI 80

  Fly   128 LRLFEVVETLGRVYLVTEWIRGGELYNHITQGGPLREIHAAPLLKQLLLAVKHMHSLGYVHRDIK 192
            :|.:||:||...:|:|.|:::.|||:::|.:.|.|:|..|....:|::..|::.|....||||:|
plant    81 IRQYEVIETTSDIYVVMEYVKSGELFDYIVEKGRLQEDEARNFFQQIISGVEYCHRNMVVHRDLK 145

  Fly   193 AENVLLLSEDRLKLADFGFSTQLINGANQKLDTFCGSPPYAAPELFSDDHYIGAPVDVWALGILL 257
            .||:||.|...:|:||||.|..:.:|  ..|.|.||||.|||||:.|...|.|..||||:.|::|
plant   146 PENLLLDSRCNIKIADFGLSNVMRDG--HFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSCGVIL 208

  Fly   258 YFMVVGNMPFRAPTIPGLKAAILKGDYLLPGQLSLPCIRLIQRILIHIPAQRPTIDDMLNSQFVT 322
            |.::.|.:||....||.|...|..|.|.||..||.....||.|:||..|.:|.||.         
plant   209 YALLCGTLPFDDENIPNLFKKIKGGIYTLPSHLSSEARDLIPRMLIVDPVKRITIP--------- 264

  Fly   323 CPKLSADLMQWEINQHTKPVKRSIFWVRSKSHR---------LRKSASLRDRYAEVVKKPAI--- 375
                       ||.||.        |.::...|         :.::..:.:...:.|.....   
plant   265 -----------EIRQHR--------WFQTHLPRYLAVSPPDTVEQAKKINEEIVQEVVNMGFDRN 310

  Fly   376 ----SMNTRQQDEMFVQNFLQPIEMGHELLVP---VSSQLKEPQSTEQAKRPTR 422
                |:..|.|::..|..:|.   :.:...||   :.|:.:|  :|:....|.|
plant   311 QVLESLRNRTQNDATVTYYLL---LDNRFRVPSGYLESEFQE--TTDSGSNPMR 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4629NP_608564.3 STKc_NIM1 63..321 CDD:270977 102/257 (40%)
S_TKc 66..321 CDD:214567 102/257 (40%)
KIN11NP_566843.1 STKc_AMPK_alpha 17..272 CDD:270981 106/285 (37%)
UBA_SnRK1_plant 294..334 CDD:270520 6/42 (14%)
AMPKA_C 391..509 CDD:213378
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.