DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4629 and Tssk4

DIOPT Version :9

Sequence 1:NP_608564.3 Gene:CG4629 / 33284 FlyBaseID:FBgn0031299 Length:570 Species:Drosophila melanogaster
Sequence 2:NP_001240817.1 Gene:Tssk4 / 71099 MGIID:1918349 Length:338 Species:Mus musculus


Alignment Length:316 Identity:86/316 - (27%)
Similarity:146/316 - (46%) Gaps:56/316 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 TPPYQRLTKALQCDPRCGHEVTIGRRIGLYRFCGDIGRGNFSKVKLAVHQLTRDKVAIKVVDLDR 101
            ||.|:.:.:      ..|:||  |:         .||.|::..|..|.:...:..||:|::...:
Mouse    13 TPAYRSVME------EYGYEV--GK---------IIGHGSYGTVYEAYYTKQKVMVAVKIISKKK 60

  Fly   102 AGLDAKALRMLSSEIATLECVHHPNILRLFEVVETLGRVYLVTEWIRGGELYNHITQGGPLREIH 166
            |..| ...:.|..||..::.:.|..::..::.:||..|||::.|..:||::...|.:.|...|..
Mouse    61 ASED-YLNKFLPREIQVMKVLRHKYLINFYQAIETTSRVYIILELAQGGDVLEWIQRYGACAETL 124

  Fly   167 AAPLLKQLLLAVKHMHSLGYVH----------RDIKAENVLLLSEDRLKLADFGF---------- 211
            |.....|:.|.:.::||.|.||          ||:|.||:||...:.:|::||||          
Mouse   125 AGKWFSQMALGIAYLHSKGIVHRLTPSLSAAGRDLKLENLLLDKRENVKISDFGFAKMVPSSQPV 189

  Fly   212 ----STQLINGANQKLDTFCGSPPYAAPELFSDDHYIGAPV-----DVWALGILLYFMVVGNMPF 267
                |.:.:|..:....|:|||..||.||:.     :|.|.     |.|::|::||.:||..:||
Mouse   190 HSSPSYRQMNSLSHLSQTYCGSFAYACPEIL-----LGLPYNPFLSDTWSMGVILYTLVVARLPF 249

  Fly   268 RAPTIPGLKAAILKGDYLLPGQLSL--PCIRLIQRILIHIPAQRPTIDDMLNSQFV 321
            ....:..|.....| :...|..|::  .|..||.: |:....:|.||.|:|...::
Mouse   250 DDTNLKKLLRETQK-EVTFPANLTISQECKNLILQ-LLRQSTKRATILDVLRDPWM 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4629NP_608564.3 STKc_NIM1 63..321 CDD:270977 79/288 (27%)
S_TKc 66..321 CDD:214567 79/285 (28%)
Tssk4NP_001240817.1 STKc_TSSK4-like 24..302 CDD:271064 83/296 (28%)
S_TKc 25..303 CDD:214567 82/296 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.