DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4629 and Brsk1

DIOPT Version :9

Sequence 1:NP_608564.3 Gene:CG4629 / 33284 FlyBaseID:FBgn0031299 Length:570 Species:Drosophila melanogaster
Sequence 2:NP_001120809.1 Gene:Brsk1 / 499073 RGDID:1563268 Length:778 Species:Rattus norvegicus


Alignment Length:300 Identity:90/300 - (30%)
Similarity:152/300 - (50%) Gaps:38/300 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 PHPPPLTTTTTPLTICQPPPPTPPYQRLTKALQCDPRCGHEVTIGRRIGLYRFCGDIGRGNFSKV 80
            |||.|            .||....|                      :|.||....:|:|....|
  Rat    18 PHPHP------------HPPQHAQY----------------------VGPYRLEKTLGKGQTGLV 48

  Fly    81 KLAVHQLTRDKVAIKVVDLDRAGLDAKALRMLSSEIATLECVHHPNILRLFEVVETLGRVYLVTE 145
            ||.||.:|..|||:|:|  :|..|....|..:..|||.|:.:.||::|:|.:|.|....:|||.|
  Rat    49 KLGVHCITGQKVAVKIV--NREKLSESVLMKVEREIAILKLIEHPHVLKLHDVYENKKYLYLVLE 111

  Fly   146 WIRGGELYNHITQGGPLREIHAAPLLKQLLLAVKHMHSLGYVHRDIKAENVLLLSEDRLKLADFG 210
            .:.||||::::.:.|.|....|....:|::.|:...||....|||:|.||:||..::.:::||||
  Rat   112 HVSGGELFDYLVKKGRLTPKEARKFFRQIVSALDFCHSYSICHRDLKPENLLLDEKNNIRIADFG 176

  Fly   211 FSTQLINGANQKLDTFCGSPPYAAPELFSDDHYIGAPVDVWALGILLYFMVVGNMPFRAPTIPGL 275
            .::  :...:..|:|.||||.||.||:...:.|.|...|:|:.|::|:.::||.:||....:..|
  Rat   177 MAS--LQVGDSLLETSCGSPHYACPEVIKGEKYDGRRADMWSCGVILFALLVGALPFDDDNLRQL 239

  Fly   276 KAAILKGDYLLPGQLSLPCIRLIQRILIHIPAQRPTIDDM 315
            ...:.:|.:.:|..:...|..|::.::...|.:|.:::.:
  Rat   240 LEKVKRGVFHMPHFIPPDCQSLLRGMIEVEPEKRLSLEQI 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4629NP_608564.3 STKc_NIM1 63..321 CDD:270977 83/252 (33%)
S_TKc 66..321 CDD:214567 82/249 (33%)
Brsk1NP_001120809.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..29 6/22 (27%)
STKc_BRSK1_2 32..285 CDD:270983 83/251 (33%)
S_TKc 34..284 CDD:214567 82/249 (33%)
UBA_BRSK 314..367 CDD:270525
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 362..548
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 719..778
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.