DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4629 and Tssk6

DIOPT Version :9

Sequence 1:NP_608564.3 Gene:CG4629 / 33284 FlyBaseID:FBgn0031299 Length:570 Species:Drosophila melanogaster
Sequence 2:NP_001099548.1 Gene:Tssk6 / 290670 RGDID:1559764 Length:273 Species:Rattus norvegicus


Alignment Length:252 Identity:99/252 - (39%)
Similarity:137/252 - (54%) Gaps:12/252 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 YRFCGDIGRGNFSKVKLAVHQLTRDKVAIKVVDLDRAGLDAKALRMLSSEIATLECVHHPNILRL 130
            |:....||.|::||||:|..:..:..|||||||..||..|. ..:.|..|::.|..|.||:|:.:
  Rat    12 YKLGRTIGEGSYSKVKVATSKKYKGTVAIKVVDRRRAPPDF-VNKFLPRELSILRGVRHPHIVHV 75

  Fly   131 FEVVETL-GRVYLVTEWIRGGELYNHITQGGPLREIHAAPLLKQLLLAVKHMHSLGYVHRDIKAE 194
            ||.:|.. |::|:|.| ....:|...:.:.|.:....|..|..|:..||:::|....||||:|.|
  Rat    76 FEFIEVCNGKLYIVME-AAATDLLQAVQRNGRIPGSQARELFSQIAGAVRYLHDHHLVHRDLKCE 139

  Fly   195 NVLLL-SEDRLKLADFGFSTQLINGANQKLDTFCGSPPYAAPELFSDDHYIGAPVDVWALGILLY 258
            ||||. .|.|:||.||||..| .:|......|:|||..||:||:.....|.....|||:||::||
  Rat   140 NVLLSPDERRVKLTDFGFGRQ-AHGYPDLSTTYCGSAAYASPEVLLGIPYDPKKYDVWSLGVVLY 203

  Fly   259 FMVVGNMPFRAPTIPGL----KAAILKGDYLLPGQLSLPCIRLIQRILIHIPAQRPT 311
            .||.|.|||....|.||    |..:|..|.|   :||..|..||..:|...|:.||:
  Rat   204 VMVTGCMPFDDSDIAGLPRRQKRGVLYPDGL---ELSERCKSLIAELLQFSPSARPS 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4629NP_608564.3 STKc_NIM1 63..321 CDD:270977 99/252 (39%)
S_TKc 66..321 CDD:214567 99/252 (39%)
Tssk6NP_001099548.1 STKc_TSSK6-like 11..267 CDD:271066 99/252 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.