DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4629 and SIK2

DIOPT Version :9

Sequence 1:NP_608564.3 Gene:CG4629 / 33284 FlyBaseID:FBgn0031299 Length:570 Species:Drosophila melanogaster
Sequence 2:NP_056006.1 Gene:SIK2 / 23235 HGNCID:21680 Length:926 Species:Homo sapiens


Alignment Length:378 Identity:123/378 - (32%)
Similarity:202/378 - (53%) Gaps:53/378 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 RIGLYRFCGDIGRGNFSKVKLAVHQLTRDKVAIKVVDLDRAGLDAKALRMLSSEIATLECVHHPN 126
            |:|.|...|.:|:|||:.|||..|::|:.:||||::  |::.|||..|..:..|:..::.:.||:
Human    16 RVGFYDIEGTLGKGNFAVVKLGRHRITKTEVAIKII--DKSQLDAVNLEKIYREVQIMKMLDHPH 78

  Fly   127 ILRLFEVVETLGRVYLVTEWIRGGELYNHITQGGPLREIHAAPLLKQLLLAVKHMHSLGYVHRDI 191
            |::|::|:||...:|||||:.:.||:::::...|.|.|..|.....|:|.||.:.|....||||:
Human    79 IIKLYQVMETKSMLYLVTEYAKNGEIFDYLANHGRLNESEARRKFWQILSAVDYCHGRKIVHRDL 143

  Fly   192 KAENVLLLSEDRLKLADFGFSTQLINGANQKLDTFCGSPPYAAPELFSDDHYIGAPVDVWALGIL 256
            ||||:||.:...:|:|||||.....:|  :.|.|:||||||||||:|....|.|..:|:|::|::
Human   144 KAENLLLDNNMNIKIADFGFGNFFKSG--ELLATWCGSPPYAAPEVFEGQQYEGPQLDIWSMGVV 206

  Fly   257 LYFMVVGNMPFRAPTIPGLKAAILKGDYLLPGQLSLPCIRLIQRILIHIPAQRPTIDDMLNSQFV 321
            ||.:|.|.:||..||:|.|:..:|:|.:.:|..:|..|..||:|:|:..|::|.||.        
Human   207 LYVLVCGALPFDGPTLPILRQRVLEGRFRIPYFMSEDCEHLIRRMLVLDPSKRLTIA-------- 263

  Fly   322 TCPKLSADLMQWEINQH-----TKPVKRSIFWVRSKSH------------RLRKSASLRDRYAEV 369
                        :|.:|     ..||:|.:.:.:.:.:            ||..|..:..     
Human   264 ------------QIKEHKWMLIEVPVQRPVLYPQEQENEPSIGEFNEQVLRLMHSLGIDQ----- 311

  Fly   370 VKKPAISMNTRQQDEMFVQNFLQPIEM-GHELLVPVSSQLKEPQSTEQAKRPT 421
             :|...|:..:..:......||....: .|....||..:|...|     :||:
Human   312 -QKTIESLQNKSYNHFAAIYFLLVERLKSHRSSFPVEQRLDGRQ-----RRPS 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4629NP_608564.3 STKc_NIM1 63..321 CDD:270977 103/257 (40%)
S_TKc 66..321 CDD:214567 102/254 (40%)
SIK2NP_056006.1 STKc_SIK 19..271 CDD:270973 104/275 (38%)
UBA_SIK2 297..341 CDD:270592 7/49 (14%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 644..666
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 742..776
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 801..896
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.