DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4629 and Mark2

DIOPT Version :9

Sequence 1:NP_608564.3 Gene:CG4629 / 33284 FlyBaseID:FBgn0031299 Length:570 Species:Drosophila melanogaster
Sequence 2:XP_006526704.1 Gene:Mark2 / 13728 MGIID:99638 Length:851 Species:Mus musculus


Alignment Length:415 Identity:138/415 - (33%)
Similarity:232/415 - (55%) Gaps:34/415 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 IGLYRFCGDIGRGNFSKVKLAVHQLTRDKVAIKVVDLDRAGLDAKALRMLSSEIATLECVHHPNI 127
            ||.||....||:|||:|||||.|.||..:||:|::  |:..|::.:|:.|..|:..::.::||||
Mouse    60 IGNYRLLKTIGKGNFAKVKLARHILTGKEVAVKII--DKTQLNSSSLQKLFREVRIMKVLNHPNI 122

  Fly   128 LRLFEVVETLGRVYLVTEWIRGGELYNHITQGGPLREIHAAPLLKQLLLAVKHMHSLGYVHRDIK 192
            ::||||:||...:|||.|:..|||:::::...|.::|..|....:|::.||::.|....||||:|
Mouse   123 VKLFEVIETEKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKFIVHRDLK 187

  Fly   193 AENVLLLSEDRLKLADFGFSTQLINGANQKLDTFCGSPPYAAPELFSDDHYIGAPVDVWALGILL 257
            |||:||.::..:|:||||||.:...|  .|||||||||||||||||....|.|..||||:||::|
Mouse   188 AENLLLDADMNIKIADFGFSNEFTFG--NKLDTFCGSPPYAAPELFQGKKYDGPEVDVWSLGVIL 250

  Fly   258 YFMVVGNMPFRAPTIPGLKAAILKGDYLLPGQLSLPCIRLIQRILIHIPAQRPTIDDMLNSQFVT 322
            |.:|.|::||....:..|:..:|:|.|.:|..:|..|..|:::.||..|::|.|::.::..:::.
Mouse   251 YTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKKFLILNPSKRGTLEQIMKDRWMN 315

  Fly   323 CPKLSADLMQW--EINQHTKPVKRSIFWVRSKSHRLRKSASLRDRYAEV-------------VKK 372
            ......:|..:  .:..:..|.:..:......:....:.:.:..||.||             ::.
Mouse   316 VGHEDDELKPYVEPLPDYKDPRRTELMVSMGYTREEIQDSLVGQRYNEVMATYLLLGYKSSELEG 380

  Fly   373 PAISMNTRQQDEMFVQNFLQPIEMGHELLVPVSSQLKEPQSTEQA--KRPTRRYMFCGSLKKKVT 435
            ..|::..|...::...:...|   .|::...||:..|:.:|::||  ..||     ..|..||..
Mouse   381 DTITLKPRPSADLTNSSAPSP---SHKVQRSVSANPKQRRSSDQAVPAIPT-----SNSYSKKTQ 437

  Fly   436 PMETE---PEKQLANGGQSIGSAKI 457
            ....|   ||::  .|.::..:||:
Mouse   438 SNNAENKRPEEE--TGRKASSTAKV 460

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4629NP_608564.3 STKc_NIM1 63..321 CDD:270977 111/257 (43%)
S_TKc 66..321 CDD:214567 109/254 (43%)
Mark2XP_006526704.1 STKc_MARK 62..314 CDD:270974 109/255 (43%)
UBA_MARK2 332..373 CDD:270589 5/40 (13%)
MARK2_C 752..850 CDD:213386
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.