DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4629 and Gm10668

DIOPT Version :9

Sequence 1:NP_608564.3 Gene:CG4629 / 33284 FlyBaseID:FBgn0031299 Length:570 Species:Drosophila melanogaster
Sequence 2:NP_001357829.1 Gene:Gm10668 / 100043566 MGIID:3642587 Length:301 Species:Mus musculus


Alignment Length:272 Identity:98/272 - (36%)
Similarity:148/272 - (54%) Gaps:12/272 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 YRFCGDIGRGNFSKVKLAVHQLTRDKVAIKVVDLDRAGLDAKALRMLSSEIATLECVHHPNILRL 130
            |:....:|.|.||.||.|.|..|...||:|::...:     :....:..|...::.:.||||::|
Mouse    27 YKMLNTLGEGKFSVVKRAFHVPTSTSVAVKILQNTK-----EYTSPICREARIMKSLSHPNIIKL 86

  Fly   131 FEVVETLGRVYLVTEWIRGGELYNHITQGGPLREIHAAPLLKQLLLAVKHMHSLGYVHRDIKAEN 195
            |.||:.....|||.|:...|||.:.|.:.|.|.|.....|..|::.||::.|....|||||||.|
Mouse    87 FHVVQRRETTYLVMEYASEGELQDRIIKVGSLEESETRRLFAQIVHAVQYCHDHHIVHRDIKASN 151

  Fly   196 VLLLSEDRLKLADFGFSTQLINGANQKLDTFCGSPPYAAPELFSDDHYIGAPVDVWALGILLYFM 260
            :|:......||.|||.:.::|.|  |||..|||:.||.||||...:.|.|.|||:|:||:||:.|
Mouse   152 ILIDYRGNAKLCDFGLAAEVIPG--QKLAGFCGTLPYCAPELLQAEKYEGPPVDIWSLGVLLFLM 214

  Fly   261 VVGNMPFRAPTIPGLKAAILKGDYLLPGQLSLPCIRLIQRILIHIPAQRPTIDDMLNSQFV---- 321
            |.||:||:......||..|:..::.:|..:|:..:.:|..:|:..|::||||..::....:    
Mouse   215 VSGNLPFQGRYFVDLKQEIISANFSIPSHVSIDILNVIIELLMINPSRRPTIHQIMRHPMIRGSE 279

  Fly   322 TC-PKLSADLMQ 332
            .| |..|..:.|
Mouse   280 ACLPPTSTQISQ 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4629NP_608564.3 STKc_NIM1 63..321 CDD:270977 94/254 (37%)
S_TKc 66..321 CDD:214567 94/254 (37%)
Gm10668NP_001357829.1 STKc_AMPK-like 26..273 CDD:270905 94/252 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.