DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atg4a and ATG4C

DIOPT Version :9

Sequence 1:NP_608563.1 Gene:Atg4a / 33283 FlyBaseID:FBgn0031298 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_116241.2 Gene:ATG4C / 84938 HGNCID:16040 Length:458 Species:Homo sapiens


Alignment Length:427 Identity:125/427 - (29%)
Similarity:183/427 - (42%) Gaps:113/427 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 RNTDVWVLGKKYNAIQE----------------------LELIRRDIQSRLWCTYRHGFSPLGEV 88
            ||:.|.:|||.|:...|                      :|..|:|..||:|.|||..|..:...
Human    37 RNSPVLLLGKCYHFKYEDEDKTLPAESGCTIEDHVIAGNVEEFRKDFISRIWLTYREEFPQIEGS 101

  Fly    89 QLTTDKGWGCMLRCGQMVLAQALIDLHLGRDWFW------------------------------- 122
            .||||.||||.||.|||:|||.||...|||.|.|                               
Human   102 ALTTDCGWGCTLRTGQMLLAQGLILHFLGRAWTWPDALNIENSDSESWTSHTVKKFTASFEASLS 166

  Fly   123 ------TP---------------DCRDATY-LKIVNRFEDVRNSFYSIHQIAQMGESQNKAVGEW 165
                  ||               :.|:..| .||::.|.|...:.:.:||:.:.|:...|..|:|
Human   167 GEREFKTPTISLKETIGKYSDDHEMRNEVYHRKIISWFGDSPLALFGLHQLIEYGKKSGKKAGDW 231

  Fly   166 LGPNTVAQILKKLV---RFDDWSSLAIHVAMDSTV----VLDDVYAS-CREGGSWKPLLLIIPLR 222
            .||..||.||:|.|   |..|...:.|:||.|.||    |:|...|| ..:....|.:::::|:|
Human   232 YGPAVVAHILRKAVEEARHPDLQGITIYVAQDCTVYNSDVIDKQSASMTSDNADDKAVIILVPVR 296

  Fly   223 LGITDINPLYVPALKRCLELDSSCGMIGGRPNQALYFLGYVDDEVLYLDPHTTQRTGAVAQKTAA 287
            ||....|..|:..:|..|.|:...|:|||:|.|:.||.|:.||.::|:|||..|....|:.|   
Human   297 LGGERTNTDYLEFVKGILSLEYCVGIIGGKPKQSYYFAGFQDDSLIYMDPHYCQSFVDVSIK--- 358

  Fly   288 AEQDYD-ETYHQKHAARLNFSAMDPSLAVCFLCKTSDSFESLLTKLKEEVLSLCSPA------LF 345
               |:. ||:|.....:::|..||||..:.|.|:....|:    :..||:..:...:      ||
Human   359 ---DFPLETFHCPSPKKMSFRKMDPSCTIGFYCRNVQDFK----RASEEITKMLKFSSKEKYPLF 416

  Fly   346 EISQTRAVDWDTTEDIDWPTMPDIDWPAGTSDSDSFA 382
            ......:.|:|.|.             ..|::.|.|:
Human   417 TFVNGHSRDYDFTS-------------TTTNEEDLFS 440

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atg4aNP_608563.1 Peptidase_C54 66..328 CDD:281417 106/323 (33%)
ATG4CNP_116241.2 Peptidase_C54 77..394 CDD:308812 106/322 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2674
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55011
OrthoDB 1 1.010 - - D332531at33208
OrthoFinder 1 1.000 - - FOG0000466
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100501
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R109
SonicParanoid 1 1.000 - - X289
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.760

Return to query results.
Submit another query.