DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atg4a and atg4c

DIOPT Version :9

Sequence 1:NP_608563.1 Gene:Atg4a / 33283 FlyBaseID:FBgn0031298 Length:411 Species:Drosophila melanogaster
Sequence 2:XP_017948502.1 Gene:atg4c / 493268 XenbaseID:XB-GENE-941086 Length:462 Species:Xenopus tropicalis


Alignment Length:390 Identity:115/390 - (29%)
Similarity:179/390 - (45%) Gaps:85/390 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 RRNTDVWVLGKKYNAIQE-----------------------LELIRRDIQSRLWCTYRHGFSPLG 86
            :||:.|::|||.|:...|                       ::..|:|..||:|.|||..|..:.
 Frog    48 KRNSPVFLLGKCYHFKYEDSSVTSDGGSNSGSESKEDLSGNVDEFRKDFISRIWLTYREEFPQIE 112

  Fly    87 EVQLTTDKGWGCMLRCGQMVLAQALIDLHLGRDWFWTP--------------------------- 124
            ....|||.||||.||.|||:|||.||...|||||.||.                           
 Frog   113 TSSWTTDCGWGCTLRTGQMLLAQGLIVHFLGRDWTWTEALDIFSSESEFWTANTARKLTPSLETS 177

  Fly   125 -----DCRDAT----------------YLKIVNRFEDVRNSFYSIHQIAQMGESQNKAVGEWLGP 168
                 :|..:.                :.||::.|.|...:::.:||:.::|::..|..|:|.||
 Frog   178 FSENNECVSSNKQPLHNCDKKSNSEDFHQKIISWFADYPLAYFGLHQLVKLGKNSGKVAGDWYGP 242

  Fly   169 NTVAQILKKLVRFD---DWSSLAIHVAMDSTVVLDDVY-ASCREGGSWKPLLLIIPLRLGITDIN 229
            ..|:.:|:|.:...   :...:.|:||.|.|:...||| ..|.: |:.|.:::::|:|||....|
 Frog   243 AVVSHLLRKAIEESSDPELQGITIYVAQDCTIYSADVYDLQCNK-GTEKAVVILVPVRLGGERTN 306

  Fly   230 PLYVPALKRCLELDSSCGMIGGRPNQALYFLGYVDDEVLYLDPHTTQRTGAVAQKTAAAEQDYDE 294
            ..|...:|..|.|:...|:|||:|.|:.||:|:.||.::|:|||..|....|:.|....     |
 Frog   307 MEYFEFVKGILSLEFCIGIIGGKPKQSYYFVGFQDDSLIYMDPHYCQSFVDVSVKNFPL-----E 366

  Fly   295 TYHQKHAARLNFSAMDPSLAVCFLCKTSDSFESL---LTKLKEEVLSLCSPALFEISQTRAVDWD 356
            ::|.....:::|..||||..:.|.|:.:..||..   |||:.:.......| ||......|.|:|
 Frog   367 SFHCPSPKKMSFKKMDPSCTIGFYCRNAREFEKAAEELTKVLKSSTKQNYP-LFTFVNGHAQDFD 430

  Fly   357  356
             Frog   431  430

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atg4aNP_608563.1 Peptidase_C54 66..328 CDD:281417 98/313 (31%)
atg4cXP_017948502.1 Peptidase_C54 89..403 CDD:367485 98/319 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55011
OrthoDB 1 1.010 - - D332531at33208
OrthoFinder 1 1.000 - - FOG0000466
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R109
SonicParanoid 1 1.000 - - X289
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.960

Return to query results.
Submit another query.