DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atg4a and Atg4c

DIOPT Version :9

Sequence 1:NP_608563.1 Gene:Atg4a / 33283 FlyBaseID:FBgn0031298 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_001101418.1 Gene:Atg4c / 313391 RGDID:1598323 Length:458 Species:Rattus norvegicus


Alignment Length:413 Identity:126/413 - (30%)
Similarity:181/413 - (43%) Gaps:108/413 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 RNTDVWVLGKKYN----------------AIQE------LELIRRDIQSRLWCTYRHGFSPLGEV 88
            ||:.|.:|||.|:                ||::      :|..|:|..||:|.|||..|..:...
  Rat    37 RNSPVLLLGKCYHFKYEDESKVLPARSGCAIEDHVIAGNVEEFRKDFISRIWLTYREEFPQIEAS 101

  Fly    89 QLTTDKGWGCMLRCGQMVLAQALIDLHLGRDWFWTPDC--------------------------- 126
            .||||.||||.||.|||:|||.||...|||.|.| ||.                           
  Rat   102 ALTTDCGWGCTLRTGQMLLAQGLILHFLGRAWTW-PDALHIESSDSDSWTSNTIHKFTASFEASL 165

  Fly   127 -------RDATYLK--------------------IVNRFEDVRNSFYSIHQIAQMGESQNKAVGE 164
                   ..|..||                    |::.|.|...:.:.:|::.:.|:...|..|:
  Rat   166 SGERELRTPAVSLKETSGKHPDDHAVQSEIYHRQIISWFGDSPVAVFGLHRLIEFGKKSGKKAGD 230

  Fly   165 WLGPNTVAQILKKLV---RFDDWSSLAIHVAMDSTV----VLDDVYASCREGGSW-KPLLLIIPL 221
            |.||..||.||:|.|   |..|...|.|:||.|.||    |:|....|...|.:. |.:::::|:
  Rat   231 WYGPAVVAHILRKAVEEARHPDLQGLTIYVAQDCTVYNSDVIDKQTDSVTAGDARDKAVIILVPV 295

  Fly   222 RLGITDINPLYVPALKRCLELDSSCGMIGGRPNQALYFLGYVDDEVLYLDPHTTQRTGAVAQKTA 286
            |||....|..|:..:|..|.|:...|:|||:|.|:.||.|:.||.::|:|||..|....|:.|  
  Rat   296 RLGGERTNIDYLEFVKGVLSLEYCVGIIGGKPKQSYYFAGFQDDSLIYMDPHYCQSFVDVSIK-- 358

  Fly   287 AAEQDYD-ETYHQKHAARLNFSAMDPSLAVCFLCKTSDSFESLLTKLKEEVLSLCSPA------L 344
                |:. ||:|.....:::|..||||..:.|.|:....||    :..||:..:...:      |
  Rat   359 ----DFPLETFHCPSPKKMSFRKMDPSCTIGFYCRNVQDFE----RASEEITKMLKISSKEKYPL 415

  Fly   345 FEISQTRAVDWDTT------EDI 361
            |......:.|:|.|      ||:
  Rat   416 FTFVNGHSRDFDFTSTAASEEDL 438

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atg4aNP_608563.1 Peptidase_C54 66..328 CDD:281417 107/324 (33%)
Atg4cNP_001101418.1 Peptidase_C54 76..395 CDD:397471 106/325 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2674
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55011
OrthoDB 1 1.010 - - D332531at33208
OrthoFinder 1 1.000 - - FOG0000466
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100501
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X289
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.730

Return to query results.
Submit another query.