DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atg4a and atg4db

DIOPT Version :9

Sequence 1:NP_608563.1 Gene:Atg4a / 33283 FlyBaseID:FBgn0031298 Length:411 Species:Drosophila melanogaster
Sequence 2:XP_009297433.2 Gene:atg4db / 100329304 ZFINID:ZDB-GENE-131025-1 Length:460 Species:Danio rerio


Alignment Length:347 Identity:118/347 - (34%)
Similarity:178/347 - (51%) Gaps:60/347 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 PR--RNTDVWVLGKKY--NAIQELELIRRDIQSRLWCTYRHGFSPLGEVQLTTDKGWGCMLRCGQ 104
            ||  :::.|.:||:.|  ::....|..||...|.||.:||.||.||....|::|.|||||||..|
Zfish    71 PRLSKSSPVCLLGQSYQLSSTGVRESFRRVFSSLLWMSYRRGFRPLDGSTLSSDAGWGCMLRSAQ 135

  Fly   105 MVLAQALIDLH-LGRDWFW------TPD-------------------C-----------RDATYL 132
            |:|||.|: || :...|.|      |.|                   |           .:.::.
Zfish   136 MLLAQGLL-LHIMPNGWTWPATHNQTKDDLEVLDAHGSLRHSGKSRRCSLGSALDGESHEERSHR 199

  Fly   133 KIVNRFEDVRNSFYSIHQIAQMGESQNKAVGEWLGPNTVAQILKKLVRFDDWSSLAIHVAMDSTV 197
            :||:.|.|:.::.:.:|::.::|.:..|..|:|.||...|.||:|.|...:.|.|.::||.|.||
Zfish   200 RIVSWFGDLPSAPFGLHRLVELGRAFGKRAGDWYGPAIAAHILQKAVSASELSDLVVYVAQDCTV 264

  Fly   198 VLDDVY---------ASCREGGSWKPLLLIIPLRLGITDINPLYVPALKRCLELDSSCGMIGGRP 253
            ...||.         ||.|....||.|:|::|:|||...:||:|...:||.|||....|:|||:|
Zfish   265 YTGDVLNLCRTSRTDASWRSTSGWKSLVLLVPVRLGSDGLNPVYTGCVKRLLELRCCLGIIGGKP 329

  Fly   254 NQALYFLGYVDDEVLYLDPHTTQRTGAVAQKTAAAEQDYD--ETYHQKHAARLNFSAMDPSLAVC 316
            ..:|||||:.:|:::|||||       ..|.....:||:.  |::|.|...::.||.||||..|.
Zfish   330 KHSLYFLGFQNDQLIYLDPH-------YCQSAVDVQQDHFPLESFHCKTVRKMAFSRMDPSCTVG 387

  Fly   317 FLCKTSDSFESLLTKLKEEVLS 338
            |..::...|.||.:.:.:.:.|
Zfish   388 FYARSRADFHSLCSDVSKALSS 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atg4aNP_608563.1 Peptidase_C54 66..328 CDD:281417 108/309 (35%)
atg4dbXP_009297433.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55011
OrthoDB 1 1.010 - - D332531at33208
OrthoFinder 1 1.000 - - FOG0000466
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100501
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X289
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.