DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IA-2 and PTP1

DIOPT Version :9

Sequence 1:NP_608562.4 Gene:IA-2 / 33277 FlyBaseID:FBgn0031294 Length:1319 Species:Drosophila melanogaster
Sequence 2:NP_010051.1 Gene:PTP1 / 851368 SGDID:S000002389 Length:335 Species:Saccharomyces cerevisiae


Alignment Length:324 Identity:88/324 - (27%)
Similarity:131/324 - (40%) Gaps:76/324 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   961 QREWEALCRY-----EAEPSAREAAS-------------QPQCAGLNRPGAPLPYDHSRVVLNHL 1007
            ||:.:.|.::     :.:...|||.:             :|:....||....:||:.:||   ||
Yeast    10 QRDTDLLGKFKFIQNQEDGRLREATNGTVNSRWSLGVSIEPRNDARNRYVNIMPYERNRV---HL 71

  Fly  1008 ANAEGLDYVNASTITDHDP----RAPAYVAAQGPLPSTLAHFWQMIWEQ---GAVVIVALCRLQE 1065
            ....|.||:|||.:..:.|    ....|:|.|||...|...||||.:..   ..:|||.:..|.|
Yeast    72 KTLSGNDYINASYVKVNVPGQSIEPGYYIATQGPTRKTWDQFWQMCYHNCPLDNIVIVMVTPLVE 136

  Fly  1066 NGEVACARYWPEEGAE----VYHIYE----------------VHLVSEHIWCDDYLVRSFYL--K 1108
            .....|.:|||..|.:    :...:|                :..|:.|...|.|.|....|  .
Yeast   137 YNREKCYQYWPRGGVDDTVRIASKWESPGGANDMTQFPSDLKIEFVNVHKVKDYYTVTDIKLTPT 201

  Fly  1109 NLRTSETRTVTQFHFLSWPHMGVPAQAKALLDF---RRKVNKSYRGRRSCPIVVHGSAGAGRTGV 1170
            :......:||..|:|..|..|..|.:...:::.   ...:|.     |..||:||.|||.||||.
Yeast   202 DPLVGPVKTVHHFYFDLWKDMNKPEEVVPIMELCAHSHSLNS-----RGNPIIVHCSAGVGRTGT 261

  Fly  1171 YILLD------LVLERMNKGAREIDIAATLEHLRD-----------QRAGVVATRQQFEFVLMA 1217
            :|.||      |..:.:.:.:|..| .||.|:.||           ||..:|.|:.||.|:..|
Yeast   262 FIALDHLMHDTLDFKNITERSRHSD-RATEEYTRDLIEQIVLQLRSQRMKMVQTKDQFLFIYHA 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IA-2NP_608562.4 Receptor_IA-2 708..795 CDD:288410
PTPc 960..1220 CDD:214550 88/324 (27%)
PTPc 995..1220 CDD:238006 79/272 (29%)
PTP1NP_010051.1 COG5599 1..335 CDD:227886 88/324 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm46470
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.