DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IA-2 and PTP1

DIOPT Version :9

Sequence 1:NP_608562.4 Gene:IA-2 / 33277 FlyBaseID:FBgn0031294 Length:1319 Species:Drosophila melanogaster
Sequence 2:NP_001031266.1 Gene:PTP1 / 843516 AraportID:AT1G71860 Length:340 Species:Arabidopsis thaliana


Alignment Length:345 Identity:100/345 - (28%)
Similarity:155/345 - (44%) Gaps:23/345 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   905 SGRITSLSKENEGRPPSSRSSTSSWSEEPALTNMDISTGHMVLSYMEDHLRNKGRLQREWEALCR 969
            :|:.:|.:....|......||..|...:.:|::..::..|..|......::|...:..|:..|..
plant     3 TGKTSSAANLFTGSTRFDLSSADSPPSKLSLSSDQLNHCHQALGVFRGKIQNPDSIAHEFTGLQA 67

  Fly   970 YEAEPSA----REAASQPQCAGLNRPGAPLPYDHSRVVLNHLANAEGLDYVNASTI-TDHDPRAP 1029
            ....||.    ...|........||....:|:|.:|:|||...::....|||||.| |.......
plant    68 NRMWPSELLLNSTVAMNSVNVEKNRYSDVVPFDKNRIVLNPCKDSSAKGYVNASLIKTSESESIS 132

  Fly  1030 AYVAAQGPLPSTLAHFWQMIWEQGAVVIVALCRLQENGE-VACARYW-PEEGAEVYHIYEVHLVS 1092
            .::|.|||||.|:..||:|:.:|...:||.|.||.:|.. |.|..|: .|:|...:.  .:.|.:
plant   133 QFIATQGPLPHTMEDFWEMVIQQHCPIIVMLTRLVDNNRTVKCGDYFQDEDGPREFG--NISLTT 195

  Fly  1093 EHIWCDDYLVRSFYLKNLRTSETRT------VTQFHFLSWPHMGVPAQAKALLDFRRKVNKSYRG 1151
            :.|...|   .|..|:||..:...|      |....:..||..|||....|:   |..:.:.|:.
plant   196 KWIKTTD---TSLMLRNLEVNYKETEDQPMSVLHIQYPEWPDHGVPKDTVAV---REILKRLYQV 254

  Fly  1152 RRSC-PIVVHGSAGAGRTGVYILLDLVLERMNKG-AREIDIAATLEHLRDQRAGVVATRQQFEFV 1214
            ..|. ||:||.|||.||||.|..:...::|:..| ...:|:|.|:...|.||.|:|.|..|:.|.
plant   255 PPSLGPIIVHCSAGIGRTGTYCAIHNTIQRILAGDMSALDLAKTVALFRKQRIGMVQTMDQYFFC 319

  Fly  1215 LMAVAEEVHAILKALPANTS 1234
            ..|:.:|:..:.....|.||
plant   320 YNAIVDELEDLTAGTNAGTS 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IA-2NP_608562.4 Receptor_IA-2 708..795 CDD:288410
PTPc 960..1220 CDD:214550 86/274 (31%)
PTPc 995..1220 CDD:238006 79/235 (34%)
PTP1NP_001031266.1 PTPc_plant_PTP1 117..321 CDD:350496 72/211 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.