DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IA-2 and RESP18

DIOPT Version :9

Sequence 1:NP_608562.4 Gene:IA-2 / 33277 FlyBaseID:FBgn0031294 Length:1319 Species:Drosophila melanogaster
Sequence 2:NP_001007090.3 Gene:RESP18 / 389075 HGNCID:33762 Length:228 Species:Homo sapiens


Alignment Length:108 Identity:20/108 - (18%)
Similarity:32/108 - (29%) Gaps:40/108 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly  1026 PRAPAYVAAQGPLPSTLAHFW------------QMIW---EQGAVVIVALCRLQE---------- 1065
            |.:|:.|||      |....|            ..:|   .:|..::|....|..          
Human    18 PLSPSAVAA------TFTETWPGSERAEPGRIQHPLWPGSSEGLQLLVCFLLLNSCPGGCSDTSA 76

  Fly  1066 ---NGEVACARYWPEEGAEVYHIYEVHLVSEHI------WCDD 1099
               ..:|...:.||.:|........:.:|.:.|      |.||
Human    77 HDGQDQVGVGQLWPLQGFATPVFQHLQVVLQQIIPQGLFWKDD 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IA-2NP_608562.4 Receptor_IA-2 708..795 CDD:288410
PTPc 960..1220 CDD:214550 20/108 (19%)
PTPc 995..1220 CDD:238006 20/108 (19%)
RESP18NP_001007090.3 RESP18 79..154 CDD:317372 9/41 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0793
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.