DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IA-2 and Ptp61F

DIOPT Version :9

Sequence 1:NP_608562.4 Gene:IA-2 / 33277 FlyBaseID:FBgn0031294 Length:1319 Species:Drosophila melanogaster
Sequence 2:NP_476687.1 Gene:Ptp61F / 38160 FlyBaseID:FBgn0267487 Length:548 Species:Drosophila melanogaster


Alignment Length:396 Identity:121/396 - (30%)
Similarity:182/396 - (45%) Gaps:60/396 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   950 MEDHLRNKGRLQREWEALCRYEAEPSAREA---------ASQPQCAGLNRPGAPLPYDHSRVVLN 1005
            :|...::||   .:|....:...|...|||         :.:....||||.....||||||:||.
  Fly    19 IEAEYKDKG---PQWHRFYKEICETCDREAKEKQFSTSESERHTNRGLNRYRDVNPYDHSRIVLK 80

  Fly  1006 HLANAEGLDYVNASTITDHDPRAPAYVAAQGPLPSTLAHFWQMIWEQGAVVIVALCRLQENGEVA 1070
            .    ..:||:||: :...:.....|:..||||..|:.|||.|:|||.:..::.|.:|.|..::.
  Fly    81 R----GSVDYINAN-LVQLERAERQYILTQGPLVDTVGHFWLMVWEQKSRAVLMLNKLMEKKQIK 140

  Fly  1071 CARYWPEE-GAE-VYHIYEVHLVSEHIWCDDY---LVRSFYLKNLRTSETRTVTQFHFLSWPHMG 1130
            |..|||.| ||: ...:..|.|..|.:..:.|   :.|.|.|.:|.|.::|.|.|||:.:||..|
  Fly   141 CHLYWPNEMGADKALKLPHVKLTVELVRLETYQNFVRRWFKLTDLETQQSREVMQFHYTTWPDFG 205

  Fly  1131 VPAQAKALLDFRRKVNKSYRGRRSC------PIVVHGSAGAGRTGVYILLDLVLERMNKGAREID 1189
            :|:...|.|.|.::|..|     .|      |.|||.|||.||:|.:.|:|..|..::|.. |.:
  Fly   206 IPSSPNAFLKFLQQVRDS-----GCLSRDVGPAVVHCSAGIGRSGTFCLVDCCLVLIDKYG-ECN 264

  Fly  1190 IAATLEHLRDQRAGVVATRQQFEFVLMAVAEEVHAILKALPANTSGEKRELD-KDPVVGGGSSST 1253
            ::..|..||..|.|::.|..|.:|...|:.|.:    |.|...|.     || ::|::...:.:.
  Fly   265 VSKVLCELRSYRMGLIQTADQLDFSYQAIIEGI----KKLHDPTF-----LDAEEPLISNDTETH 320

  Fly  1254 TTKE--PLKEDKAQEAAEEEAPTS------SSKAAAAAKKE---KEKDKDK-----EEKQAKDQA 1302
            |..|  |....:.|......||.|      :.:||.|...|   ||..||.     .:......|
  Fly   321 TLDELPPPLPPRVQSLNLPLAPNSGGILSLNMRAAQANGAESIGKELSKDALNNFINQHDMIHDA 385

  Fly  1303 KVAEPR 1308
            :||:.|
  Fly   386 EVADSR 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IA-2NP_608562.4 Receptor_IA-2 708..795 CDD:288410
PTPc 960..1220 CDD:214550 92/279 (33%)
PTPc 995..1220 CDD:238006 83/235 (35%)
Ptp61FNP_476687.1 PTPc 34..295 CDD:214550 91/271 (34%)
PTPc 62..295 CDD:238006 87/243 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443528
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm46470
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.