DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IA-2 and Ptpmeg2

DIOPT Version :9

Sequence 1:NP_608562.4 Gene:IA-2 / 33277 FlyBaseID:FBgn0031294 Length:1319 Species:Drosophila melanogaster
Sequence 2:NP_572576.1 Gene:Ptpmeg2 / 31907 FlyBaseID:FBgn0028341 Length:827 Species:Drosophila melanogaster


Alignment Length:381 Identity:132/381 - (34%)
Similarity:195/381 - (51%) Gaps:46/381 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   884 AGGGGNSTGGAAGGGSNEPAPSGRITSLSKENEGRPPSSRSSTSSWSEEPALTNMDISTGHMVLS 948
            ||..|.:.|....||       |...|   ||   ||||.|  |.:|::.:|...:  .....:.
  Fly   472 AGAAGAAAGTTTNGG-------GEFWS---EN---PPSSAS--SGFSDDDSLAGQE--GDPKPID 519

  Fly   949 YMEDHLRNKGR--LQREWEALCRYEAEPS---AREAASQPQCAGLNRPGAPLPYDHSRVVLNHLA 1008
            .:...::.:||  |.:|:..:.....|.:   ||..|:..:    ||....|.||||||||.|..
  Fly   520 QIVQMVKQRGRHGLIKEYADIRNRAPEGTFLHARMRANLTK----NRYTDVLCYDHSRVVLAHED 580

  Fly  1009 NAEGLDYVNASTITDHDPRAPAYVAAQGPLPSTLAHFWQMIWEQGAVVIVALCRLQENGEVACAR 1073
            ..|..||:||:.: |...:..||::.|||||.|...||:|||||..:|||...|:.|.|.|.|.:
  Fly   581 GDEPSDYINANFV-DGYKQKNAYISTQGPLPKTSQDFWRMIWEQHCLVIVMTTRVMERGRVKCGQ 644

  Fly  1074 YW--PEEGAEVYHIYEVHLVSEHIWC-DDYLVRSFYLKNLRTSETRTVTQFHFLSWPHMGVPAQA 1135
            ||  .||.:..:..|.|..:|  :.| :||:|.|..|:|::|.|.|.|:.:.|.|||..|||:.|
  Fly   645 YWEPTEESSLEFGDYHVRTIS--VECNEDYMVASLELRNIKTDEIRNVSHWQFTSWPDYGVPSSA 707

  Fly  1136 KALLDFRRKVNK-----------SYRGR-RSCPIVVHGSAGAGRTGVYILLDLVLERMNKGAREI 1188
            .|:|:|.:||.:           ::.|. |..|||||.|||.||||.:|.||:.:.|: :.....
  Fly   708 MAMLNFLQKVREKQAQLVQGLGDTWAGHPRGPPIVVHCSAGIGRTGTFITLDICISRL-EDVGTA 771

  Fly  1189 DIAATLEHLRDQRAGVVATRQQFEFVLMAVAEEVHAILKALPANTSG-EKRELDKD 1243
            ||..|:|.:|.|||..:....|:.|..:|:.|..::.......:.:| ::||.|.:
  Fly   772 DIRGTVEKIRSQRAYSIQMPDQYVFCHLALIEYAYSRGMLQTVDLAGFDEREPDSE 827

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IA-2NP_608562.4 Receptor_IA-2 708..795 CDD:288410
PTPc 960..1220 CDD:214550 107/277 (39%)
PTPc 995..1220 CDD:238006 99/239 (41%)
Ptpmeg2NP_572576.1 CRAL_TRIO_N <114..144 CDD:215024
SEC14 170..314 CDD:238099
Y_phosphatase 557..803 CDD:278528 101/253 (40%)
PTPc 559..803 CDD:238006 101/251 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443529
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm46470
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.