DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IA-2 and Resp18

DIOPT Version :10

Sequence 1:NP_608562.4 Gene:IA-2 / 33277 FlyBaseID:FBgn0031294 Length:1319 Species:Drosophila melanogaster
Sequence 2:NP_033075.1 Gene:Resp18 / 19711 MGIID:1098222 Length:175 Species:Mus musculus


Alignment Length:125 Identity:29/125 - (23%)
Similarity:41/125 - (32%) Gaps:33/125 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 VRGCGAGGGGLLCCSLDALSRPAKLLQFGVLLLILLLATHGDLAQAEGNVGCQFVRTL-CIPHSE 190
            ::..|:|...||.|.|...|||.....         :..|    ..:|.||.:.:.|. .:..|.
Mouse     5 LKPAGSGHLQLLVCFLLLYSRPGSCSD---------INAH----DGQGQVGSEQLWTFQGLIASV 56

  Fly   191 VCYDDNIFGKCIPTTGVDVEDIE---KTPLTEDQSRVLATMLEELQGAGLGWDHPYVQCR 247
            ..|...||.:.:|......:||.   .|...|..||:                ||...||
Mouse    57 FQYLQLIFHQIVPEGMFWADDIAYELMTKKVEHLSRL----------------HPQYPCR 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IA-2NP_608562.4 Receptor_IA-2 705..795 CDD:463293
PTP_DSP_cys 942..1225 CDD:475123
Resp18NP_033075.1 RESP18 37..140 CDD:464394 19/80 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.