DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IA-2 and Ptp36E

DIOPT Version :10

Sequence 1:NP_608562.4 Gene:IA-2 / 33277 FlyBaseID:FBgn0031294 Length:1319 Species:Drosophila melanogaster
Sequence 2:XP_061517629.1 Gene:Ptp36E / 1277872 VectorBaseID:AGAMI1_001392 Length:682 Species:Anopheles gambiae


Alignment Length:69 Identity:15/69 - (21%)
Similarity:28/69 - (40%) Gaps:9/69 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   243 DLPVGIFRP--PIVLSTYREPIAGWTDNLNGPAGLCLWT------VKGYVRV-IHGNGRKKANLV 298
            |.|.|:..|  .::|:...:..|...::.|.......||      .|.:.|. ..|:|..:...:
Mosquito    57 DPPCGVLDPKEAVLLAVSCDAFAFGQEDTNNDRITVEWTNTPDGAAKQFRREWFQGDGMVRRKNL 121

  Fly   299 PVDY 302
            |::|
Mosquito   122 PIEY 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IA-2NP_608562.4 Receptor_IA-2 705..795 CDD:463293
PTP_DSP_cys 942..1225 CDD:475123
Ptp36EXP_061517629.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.