DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4341 and CYC8

DIOPT Version :9

Sequence 1:NP_608558.1 Gene:CG4341 / 33276 FlyBaseID:FBgn0028481 Length:938 Species:Drosophila melanogaster
Sequence 2:NP_009670.3 Gene:CYC8 / 852410 SGDID:S000000316 Length:966 Species:Saccharomyces cerevisiae


Alignment Length:417 Identity:93/417 - (22%)
Similarity:160/417 - (38%) Gaps:89/417 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   575 MSLRTLRRNADWRDEESL-YRSAIAINP--PKALGNLGSVLSSQGRYEEAKQVLQEAIRFRPNMA 636
            :|:.:|.......|..:: |.:.:..||  .|||.:|..:..|:..::.|.::.:.|:...|.::
Yeast    50 LSIASLAETLGDGDRAAMAYDATLQFNPSSAKALTSLAHLYRSRDMFQRAAELYERALLVNPELS 114

  Fly   637 DVHFNLG----ILHQNQQVYPAAVECFQRAIKF--RPNLAVAYLNLGISFIALGKRQQAIEILQA 695
            ||...||    :|...|:.|.|    :|:|:..  .||:...:..:||.:...|....|.|..  
Yeast   115 DVWATLGHCYLMLDDLQRAYNA----YQQALYHLSNPNVPKLWHGIGILYDRYGSLDYAEEAF-- 173

  Fly   696 GSNLDGAAVRDRTAHDQARSSAYLQLGALYVEQGKLQRALAIYREALSSLPGLPQQREILYQRIG 760
                  |.|.:...|.:..:..|.:||.:|..|||..:||..:|..|...|...|:.:|.:| :|
Yeast   174 ------AKVLELDPHFEKANEIYFRLGIIYKHQGKWSQALECFRYILPQPPAPLQEWDIWFQ-LG 231

  Fly   761 DVLGRLQQWDEAE----------RHHRAALE-------------LQPNQVAAHLSYGITLARNSS 802
            .||..:.:|..|:          :||...|:             ..|.:...:|     |....:
Yeast   232 SVLESMGEWQGAKEAYEHVLAQNQHHAKVLQQLGCLYGMSNVQFYDPQKALDYL-----LKSLEA 291

  Fly   803 RASEAEMWFK--RALKLAPEQASVYHHYAEFLSLQSR-----------HHESAIY------HRRA 848
            ..|:|..|:.  |...:..:..:.|..:.:.::..||           :::.:.|      :.||
Yeast   292 DPSDATTWYHLGRVHMIRTDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDALDAYTRA 356

  Fly   849 AELAPND----YTLVVAAATAMRLLDRKVDAEMWYRKAVALRPGDAHAHTNLGAILHLL------ 903
            ..|.|..    |.|.....|....|...:||   |::|..|...:.|....|.|:...|      
Yeast   357 IRLNPYISEVWYDLGTLYETCNNQLSDALDA---YKQAARLDVNNVHIRERLEALTKQLENPGNI 418

  Fly   904 -----GRTNHAAASYKAALR--LQPGD 923
                 ..||.:.|.....|:  |||.|
Yeast   419 NKSNGAPTNASPAPPPVILQPTLQPND 445

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4341NP_608558.1 PMT_2 112..>232 CDD:304453
DUF1736 275..343 CDD:285594
TPR_11 602..667 CDD:290150 18/70 (26%)
TPR_1 602..634 CDD:278916 7/31 (23%)
TPR repeat 602..630 CDD:276809 7/27 (26%)
TPR repeat 635..665 CDD:276809 10/33 (30%)
TPR_11 636..700 CDD:290150 17/69 (25%)
TPR_1 636..668 CDD:278916 10/37 (27%)
TPR repeat 670..694 CDD:276809 5/23 (22%)
TPR_11 714..784 CDD:290150 23/92 (25%)
TPR repeat 715..743 CDD:276809 10/27 (37%)
TPR repeat 748..782 CDD:276809 11/56 (20%)
TPR_11 755..819 CDD:290150 16/88 (18%)
TPR repeat 787..816 CDD:276809 6/30 (20%)
TPR_11 821..887 CDD:290150 17/86 (20%)
TPR repeat 822..850 CDD:276809 6/44 (14%)
TPR repeat 855..885 CDD:276809 8/33 (24%)
TPR_11 <874..921 CDD:290150 14/59 (24%)
TPR repeat 890..918 CDD:276809 7/38 (18%)
CYC8NP_009670.3 TPR <38..142 CDD:223533 24/95 (25%)
TPR repeat 46..74 CDD:276809 4/23 (17%)
TPR repeat 80..108 CDD:276809 7/27 (26%)
TPR 94..391 CDD:223533 68/317 (21%)
TPR repeat 113..143 CDD:276809 10/33 (30%)
TPR repeat 150..178 CDD:276809 7/35 (20%)
TPR repeat 184..211 CDD:276809 9/26 (35%)
TPR repeat 223..253 CDD:276809 7/30 (23%)
TPR repeat 258..290 CDD:276809 4/36 (11%)
TPR repeat 296..324 CDD:276809 4/27 (15%)
TPR repeat 329..359 CDD:276809 3/29 (10%)
TPR repeat 364..393 CDD:276809 8/31 (26%)
Herpes_BLLF1 <697..944 CDD:282904
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1124
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.