powered by:
Protein Alignment CG4341 and TAH1
DIOPT Version :9
Sequence 1: | NP_608558.1 |
Gene: | CG4341 / 33276 |
FlyBaseID: | FBgn0028481 |
Length: | 938 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_009986.1 |
Gene: | TAH1 / 850424 |
SGDID: | S000000656 |
Length: | 111 |
Species: | Saccharomyces cerevisiae |
Alignment Length: | 63 |
Identity: | 21/63 - (33%) |
Similarity: | 33/63 - (52%) |
Gaps: | 4/63 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 649 QQVYPAAVECFQRAIKFRPNLAVAYLNLGISFIALGKRQQAIEILQAG----SNLDGAAVRDR 707
|.:|..||.|:.:.|..:|...|.|.|..::.|.||:..|||::.|.| |..:..|:|.:
Yeast 17 QGLYREAVHCYDQLITAQPQNPVGYSNKAMALIKLGEYTQAIQMCQQGLRYTSTAEHVAIRSK 79
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E2759_KOG1124 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.