DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG4341 and TAH1

DIOPT Version :9

Sequence 1:	NP_608558.1	Gene:	CG4341 / 33276	FlyBaseID:	FBgn0028481	Length:	938	Species:	Drosophila melanogaster
Sequence 2:	NP_009986.1	Gene:	TAH1 / 850424	SGDID:	S000000656	Length:	111	Species:	Saccharomyces cerevisiae

Alignment Length:	63	Identity:	21/63 - (33%)
Similarity:	33/63 - (52%)	Gaps:	4/63 - (6%)

- Green bases have known domain annotations that are detailed below.

  Fly   649 QQVYPAAVECFQRAIKFRPNLAVAYLNLGISFIALGKRQQAIEILQAG----SNLDGAAVRDR 707
            |.:|..||.|:.:.|..:|...|.|.|..::.|.||:..|||::.|.|    |..:..|:|.:
Yeast    17 QGLYREAVHCYDQLITAQPQNPVGYSNKAMALIKLGEYTQAIQMCQQGLRYTSTAEHVAIRSK 79

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG4341	NP_608558.1	PMT_2	112..>232	CDD:304453
		DUF1736	275..343	CDD:285594
		TPR_11	602..667	CDD:290150	6/17 (35%)
		TPR_1	602..634	CDD:278916
		TPR repeat	602..630	CDD:276809
		TPR repeat	635..665	CDD:276809	6/15 (40%)
		TPR_11	636..700	CDD:290150	19/54 (35%)
		TPR_1	636..668	CDD:278916	6/18 (33%)
		TPR repeat	670..694	CDD:276809	9/23 (39%)
		TPR_11	714..784	CDD:290150
		TPR repeat	715..743	CDD:276809
		TPR repeat	748..782	CDD:276809
		TPR_11	755..819	CDD:290150
		TPR repeat	787..816	CDD:276809
		TPR_11	821..887	CDD:290150
		TPR repeat	822..850	CDD:276809
		TPR repeat	855..885	CDD:276809
		TPR_11	<874..921	CDD:290150
		TPR repeat	890..918	CDD:276809
TAH1	NP_009986.1	TPR repeat	8..32	CDD:276809	5/14 (36%)
		C39_PA2778_fam	<11..68	CDD:411481	18/50 (36%)
		TPR repeat	37..67	CDD:276809	11/29 (38%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E2759_KOG1124
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900