DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tmtc2 and TAH1

DIOPT Version :10

Sequence 1:NP_608558.1 Gene:Tmtc2 / 33276 FlyBaseID:FBgn0028481 Length:938 Species:Drosophila melanogaster
Sequence 2:NP_009986.1 Gene:TAH1 / 850424 SGDID:S000000656 Length:111 Species:Saccharomyces cerevisiae


Alignment Length:63 Identity:21/63 - (33%)
Similarity:33/63 - (52%) Gaps:4/63 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   649 QQVYPAAVECFQRAIKFRPNLAVAYLNLGISFIALGKRQQAIEILQAG----SNLDGAAVRDR 707
            |.:|..||.|:.:.|..:|...|.|.|..::.|.||:..|||::.|.|    |..:..|:|.:
Yeast    17 QGLYREAVHCYDQLITAQPQNPVGYSNKAMALIKLGEYTQAIQMCQQGLRYTSTAEHVAIRSK 79

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tmtc2NP_608558.1 TMTC_DUF1736 270..343 CDD:462468
TPR 597..852 CDD:440225 21/63 (33%)
TPR repeat 602..630 CDD:276809
TPR repeat 635..665 CDD:276809 6/15 (40%)
TPR repeat 670..694 CDD:276809 9/23 (39%)
TPR repeat 715..743 CDD:276809
TPR repeat 748..782 CDD:276809
TPR 780..>933 CDD:440225
TPR repeat 787..816 CDD:276809
TPR repeat 822..850 CDD:276809
TPR repeat 855..885 CDD:276809
TPR repeat 890..918 CDD:276809
TAH1NP_009986.1 TPR repeat 8..32 CDD:276809 5/14 (36%)
Spy <11..>66 CDD:443119 18/48 (38%)
TPR repeat 37..67 CDD:276809 11/29 (38%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.