DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4341 and ODAD4

DIOPT Version :9

Sequence 1:NP_608558.1 Gene:CG4341 / 33276 FlyBaseID:FBgn0028481 Length:938 Species:Drosophila melanogaster
Sequence 2:NP_113609.1 Gene:ODAD4 / 83538 HGNCID:25280 Length:672 Species:Homo sapiens


Alignment Length:274 Identity:49/274 - (17%)
Similarity:105/274 - (38%) Gaps:72/274 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   586 WRDEESLYR--------------------SAIAINPPKALGNLGSVL---SSQGRYEEAKQVLQE 627
            ||.::.:|.                    |..|....|:|.::..:|   |::|..::|::||::
Human   239 WRQQKPIYARERDRKLMQEKWLRDHKRRPSQTAHYILKSLEDIDMLLTSGSAEGSLQKAEKVLKK 303

  Fly   628 AIRFR----PNMADVHFNLGILHQNQQVYPAAVECFQRAIKFRPNLAVAYLNLGISFIALGKRQQ 688
            .:.:.    ||..::..||                              |..:|.:.|.||:.:.
Human   304 VLEWNKEEVPNKDELVGNL------------------------------YSCIGNAQIELGQMEA 338

  Fly   689 AIEILQAGSNLDGAAVRDRTAHDQARSSAYLQLGALYVEQGKLQRALAIYREALSSLPGLPQQRE 753
            |::     |:.....:........|:|.|...:|.::...||.|:|:..:.|.: .|.....::.
Human   339 ALQ-----SHRKDLEIAKEYDLPDAKSRALDNIGRVFARVGKFQQAIDTWEEKI-PLAKTTLEKT 397

  Fly   754 ILYQRIGDVLGRLQQWDEAERHHRAALEL--QPNQVAAHLSYGITLARNSSRASEAEMW---FKR 813
            .|:..||.....|.|..:|:.:...:.:.  :...:...|:..:.:|:...:..:.|..   |::
Human   398 WLFHEIGRCYLELDQAWQAQNYGEKSQQCAEEEGDIEWQLNASVLVAQAQVKLRDFESAVNNFEK 462

  Fly   814 ALKLAPEQASVYHH 827
            ||    |:|.:.|:
Human   463 AL----ERAKLVHN 472

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4341NP_608558.1 PMT_2 112..>232 CDD:304453
DUF1736 275..343 CDD:285594
TPR_11 602..667 CDD:290150 12/71 (17%)
TPR_1 602..634 CDD:278916 8/38 (21%)
TPR repeat 602..630 CDD:276809 8/30 (27%)
TPR repeat 635..665 CDD:276809 2/29 (7%)
TPR_11 636..700 CDD:290150 9/63 (14%)
TPR_1 636..668 CDD:278916 2/31 (6%)
TPR repeat 670..694 CDD:276809 6/23 (26%)
TPR_11 714..784 CDD:290150 15/71 (21%)
TPR repeat 715..743 CDD:276809 8/27 (30%)
TPR repeat 748..782 CDD:276809 6/33 (18%)
TPR_11 755..819 CDD:290150 12/68 (18%)
TPR repeat 787..816 CDD:276809 5/31 (16%)
TPR_11 821..887 CDD:290150 2/7 (29%)
TPR repeat 822..850 CDD:276809 2/6 (33%)
TPR repeat 855..885 CDD:276809
TPR_11 <874..921 CDD:290150
TPR repeat 890..918 CDD:276809
ODAD4NP_113609.1 TPR 1. /evidence=ECO:0000255 13..46
TPR_11 16..78 CDD:290150
TPR repeat 16..41 CDD:276809
TPR repeat 46..76 CDD:276809
TPR 2. /evidence=ECO:0000255 48..80
TPR_11 49..112 CDD:290150
TPR 3. /evidence=ECO:0000255 81..114
TPR repeat 81..109 CDD:276809
TPR 4. /evidence=ECO:0000255 275..311 8/35 (23%)
TPR repeat 311..349 CDD:276809 11/72 (15%)
TPR_12 316..385 CDD:290160 17/103 (17%)
TPR 5. /evidence=ECO:0000255 320..353 9/67 (13%)
TPR 6. /evidence=ECO:0000255 360..393 9/33 (27%)
TPR repeat 360..385 CDD:276809 7/24 (29%)
TPR_12 361..429 CDD:290160 14/68 (21%)
TPR 7. /evidence=ECO:0000255 397..430 6/32 (19%)
TPR_12 398..468 CDD:290160 13/73 (18%)
TPR repeat 431..465 CDD:276809 6/37 (16%)
TPR 8. /evidence=ECO:0000255 437..470 8/36 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 527..672
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1124
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.