Sequence 1: | NP_608558.1 | Gene: | CG4341 / 33276 | FlyBaseID: | FBgn0028481 | Length: | 938 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_113609.1 | Gene: | ODAD4 / 83538 | HGNCID: | 25280 | Length: | 672 | Species: | Homo sapiens |
Alignment Length: | 274 | Identity: | 49/274 - (17%) |
---|---|---|---|
Similarity: | 105/274 - (38%) | Gaps: | 72/274 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 586 WRDEESLYR--------------------SAIAINPPKALGNLGSVL---SSQGRYEEAKQVLQE 627
Fly 628 AIRFR----PNMADVHFNLGILHQNQQVYPAAVECFQRAIKFRPNLAVAYLNLGISFIALGKRQQ 688
Fly 689 AIEILQAGSNLDGAAVRDRTAHDQARSSAYLQLGALYVEQGKLQRALAIYREALSSLPGLPQQRE 753
Fly 754 ILYQRIGDVLGRLQQWDEAERHHRAALEL--QPNQVAAHLSYGITLARNSSRASEAEMW---FKR 813
Fly 814 ALKLAPEQASVYHH 827 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG4341 | NP_608558.1 | PMT_2 | 112..>232 | CDD:304453 | |
DUF1736 | 275..343 | CDD:285594 | |||
TPR_11 | 602..667 | CDD:290150 | 12/71 (17%) | ||
TPR_1 | 602..634 | CDD:278916 | 8/38 (21%) | ||
TPR repeat | 602..630 | CDD:276809 | 8/30 (27%) | ||
TPR repeat | 635..665 | CDD:276809 | 2/29 (7%) | ||
TPR_11 | 636..700 | CDD:290150 | 9/63 (14%) | ||
TPR_1 | 636..668 | CDD:278916 | 2/31 (6%) | ||
TPR repeat | 670..694 | CDD:276809 | 6/23 (26%) | ||
TPR_11 | 714..784 | CDD:290150 | 15/71 (21%) | ||
TPR repeat | 715..743 | CDD:276809 | 8/27 (30%) | ||
TPR repeat | 748..782 | CDD:276809 | 6/33 (18%) | ||
TPR_11 | 755..819 | CDD:290150 | 12/68 (18%) | ||
TPR repeat | 787..816 | CDD:276809 | 5/31 (16%) | ||
TPR_11 | 821..887 | CDD:290150 | 2/7 (29%) | ||
TPR repeat | 822..850 | CDD:276809 | 2/6 (33%) | ||
TPR repeat | 855..885 | CDD:276809 | |||
TPR_11 | <874..921 | CDD:290150 | |||
TPR repeat | 890..918 | CDD:276809 | |||
ODAD4 | NP_113609.1 | TPR 1. /evidence=ECO:0000255 | 13..46 | ||
TPR_11 | 16..78 | CDD:290150 | |||
TPR repeat | 16..41 | CDD:276809 | |||
TPR repeat | 46..76 | CDD:276809 | |||
TPR 2. /evidence=ECO:0000255 | 48..80 | ||||
TPR_11 | 49..112 | CDD:290150 | |||
TPR 3. /evidence=ECO:0000255 | 81..114 | ||||
TPR repeat | 81..109 | CDD:276809 | |||
TPR 4. /evidence=ECO:0000255 | 275..311 | 8/35 (23%) | |||
TPR repeat | 311..349 | CDD:276809 | 11/72 (15%) | ||
TPR_12 | 316..385 | CDD:290160 | 17/103 (17%) | ||
TPR 5. /evidence=ECO:0000255 | 320..353 | 9/67 (13%) | |||
TPR 6. /evidence=ECO:0000255 | 360..393 | 9/33 (27%) | |||
TPR repeat | 360..385 | CDD:276809 | 7/24 (29%) | ||
TPR_12 | 361..429 | CDD:290160 | 14/68 (21%) | ||
TPR 7. /evidence=ECO:0000255 | 397..430 | 6/32 (19%) | |||
TPR_12 | 398..468 | CDD:290160 | 13/73 (18%) | ||
TPR repeat | 431..465 | CDD:276809 | 6/37 (16%) | ||
TPR 8. /evidence=ECO:0000255 | 437..470 | 8/36 (22%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 527..672 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG1124 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |