DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tmtc2 and TOC64-III

DIOPT Version :10

Sequence 1:NP_608558.1 Gene:Tmtc2 / 33276 FlyBaseID:FBgn0028481 Length:938 Species:Drosophila melanogaster
Sequence 2:NP_188424.2 Gene:TOC64-III / 819660 AraportID:AT3G17970 Length:589 Species:Arabidopsis thaliana


Alignment Length:65 Identity:18/65 - (27%)
Similarity:22/65 - (33%) Gaps:24/65 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 TITADSEG----------VCC--EKLESLNLIGNSLKQFDFAVVM----------YMPQFQRLFL 58
            |:..|.||          .||  |.....||.....:.|.||:.|          |.|.|  :||
plant   608 TLIEDGEGRTDLNSTCGRRCCKPEPASYNNLYYTCQELFKFAIGMGDLEFTDNYKYKPVF--IFL 670

  Fly    59  58
            plant   671  670

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tmtc2NP_608558.1 TMTC_DUF1736 270..343 CDD:462468
TPR 597..852 CDD:440225
TPR repeat 602..630 CDD:276809
TPR repeat 635..665 CDD:276809
TPR repeat 670..694 CDD:276809
TPR repeat 715..743 CDD:276809
TPR repeat 748..782 CDD:276809
TPR 780..>933 CDD:440225
TPR repeat 787..816 CDD:276809
TPR repeat 822..850 CDD:276809
TPR repeat 855..885 CDD:276809
TPR repeat 890..918 CDD:276809
TOC64-IIINP_188424.2 Amidase 33..451 CDD:450241
NlpI <467..>580 CDD:443815
TPR repeat 474..502 CDD:276809
TPR repeat 507..537 CDD:276809
TPR repeat 542..569 CDD:276809
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.