DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4341 and LONRF3

DIOPT Version :9

Sequence 1:NP_608558.1 Gene:CG4341 / 33276 FlyBaseID:FBgn0028481 Length:938 Species:Drosophila melanogaster
Sequence 2:XP_005262533.1 Gene:LONRF3 / 79836 HGNCID:21152 Length:811 Species:Homo sapiens


Alignment Length:421 Identity:84/421 - (19%)
Similarity:140/421 - (33%) Gaps:144/421 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   603 KALGNLGSVLSSQGRYEEAKQVLQEAIRFRPNMADVHFNLGILHQNQQVYPAAVE----CFQRAI 663
            |.|......|:|:||..||.:|.::                 |.:.||:....:|    |....:
Human    68 KVLLTQADALASRGRIREALEVYRQ-----------------LSERQQLVAEQLEQLVRCLAEKV 115

  Fly   664 KFRPNLAVAYLNLGISFIALGKRQQAIEILQAGSNLDGAAV------RDRTAHDQARSSAYLQLG 722
            .....||.|..:.|.:  |.|    .:...:.|:....||.      :.|..|........|..|
Human   116 PQGEALAPAPPDEGST--ASG----TVAAEETGAAAAAAATEVWDGFKCRKCHGFLSDPVSLSCG 174

  Fly   723 ----ALYVEQGK-LQRALAIYREALSSL----------------PGLPQQREILYQRIGDVLGRL 766
                .|.:|:|: ..|..|:....||:|                |..|.:..::   :..:||:|
Human   175 HTFCKLCLERGRAADRRCALCGVKLSALMVATGRARGARRAGQQPPPPLRVNVV---LSGLLGKL 236

  Fly   767 --------QQWDEAERHHRAALELQPNQVAAHLSYGITLARNSSRASEAEMWFKRALKLAPEQAS 823
                    |...|..|.:|      ..||.|.|                 :.:..|:||||....
Human   237 FPGPARASQLRHEGNRLYR------ERQVEAAL-----------------LKYNEAVKLAPNDHL 278

  Fly   824 VYHHYAE-FLSLQSRHHESAIYHRR-AAELAPNDYTLVVAAATAMRLLDRKVDAEMWYRKAVALR 886
            :|.:.:: :.:|:|  ||:|::... |.:|.|..:......|.|:..|.:..:|...:...|:|.
Human   279 LYSNRSQIYFTLES--HENALHDAEIACKLRPMGFKAHFRKAQALATLGKVEEALREFLYCVSLD 341

  Fly   887 ----------------------PGDAHAHT---------------------------NLGAILHL 902
                                  |||:..|:                           ||..:|..
Human   342 GKNKRARCEAQRLLLSFFSPSVPGDSQEHSPDILKLLAPHPRLKENVESMTTEVTSHNLPRLLQD 406

  Fly   903 LGRTNHAAASYKAALRLQPGDAITLGNLAKL 933
            .....|.::..:||.|   ||..:|.:.||:
Human   407 NLELPHCSSQEEAAAR---GDGSSLMDPAKV 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4341NP_608558.1 PMT_2 112..>232 CDD:304453
DUF1736 275..343 CDD:285594
TPR_11 602..667 CDD:290150 14/67 (21%)
TPR_1 602..634 CDD:278916 9/30 (30%)
TPR repeat 602..630 CDD:276809 9/26 (35%)
TPR repeat 635..665 CDD:276809 5/33 (15%)
TPR_11 636..700 CDD:290150 12/67 (18%)
TPR_1 636..668 CDD:278916 5/35 (14%)
TPR repeat 670..694 CDD:276809 5/23 (22%)
TPR_11 714..784 CDD:290150 19/98 (19%)
TPR repeat 715..743 CDD:276809 7/32 (22%)
TPR repeat 748..782 CDD:276809 8/41 (20%)
TPR_11 755..819 CDD:290150 14/71 (20%)
TPR repeat 787..816 CDD:276809 4/28 (14%)
TPR_11 821..887 CDD:290150 15/89 (17%)
TPR repeat 822..850 CDD:276809 7/29 (24%)
TPR repeat 855..885 CDD:276809 5/29 (17%)
TPR_11 <874..921 CDD:290150 14/95 (15%)
TPR repeat 890..918 CDD:276809 7/54 (13%)
LONRF3XP_005262533.1 RING 158..195 CDD:302633 9/36 (25%)
TPR_11 242..308 CDD:290150 21/90 (23%)
TPR repeat 243..271 CDD:276809 9/50 (18%)
TPR repeat 276..306 CDD:276809 7/31 (23%)
TPR repeat 311..334 CDD:276809 4/22 (18%)
RING 518..557 CDD:238093
LON_substr_bdg 607..808 CDD:280370
LON 618..796 CDD:271862
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1124
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.