| Sequence 1: | NP_608558.1 | Gene: | CG4341 / 33276 | FlyBaseID: | FBgn0028481 | Length: | 938 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001287802.1 | Gene: | ifit14 / 794786 | ZFINID: | ZDB-GENE-131120-20 | Length: | 433 | Species: | Danio rerio |
| Alignment Length: | 199 | Identity: | 52/199 - (26%) |
|---|---|---|---|
| Similarity: | 85/199 - (42%) | Gaps: | 43/199 - (21%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 671 VAYLNLGISFI--ALGKRQQAIEILQAGSNLDGAAVRDRTAHDQARSSAYLQLGALYVEQGKLQR 733
Fly 734 ALAIYREALSSL-------PGLPQQREILYQRIGDVLGRLQQWDEAER--HHRAALELQPNQVAA 789
Fly 790 HLSYGITLARNSSRASEAEMWFKRALKLAPEQASVYHHYAEFLSLQSRHHESAIYHRRAAELAPN 854
Fly 855 DYTL 858 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG4341 | NP_608558.1 | PMT_2 | 112..>232 | CDD:304453 | |
| DUF1736 | 275..343 | CDD:285594 | |||
| TPR_11 | 602..667 | CDD:290150 | |||
| TPR_1 | 602..634 | CDD:278916 | |||
| TPR repeat | 602..630 | CDD:276809 | |||
| TPR repeat | 635..665 | CDD:276809 | |||
| TPR_11 | 636..700 | CDD:290150 | 12/30 (40%) | ||
| TPR_1 | 636..668 | CDD:278916 | |||
| TPR repeat | 670..694 | CDD:276809 | 10/24 (42%) | ||
| TPR_11 | 714..784 | CDD:290150 | 18/78 (23%) | ||
| TPR repeat | 715..743 | CDD:276809 | 7/27 (26%) | ||
| TPR repeat | 748..782 | CDD:276809 | 6/35 (17%) | ||
| TPR_11 | 755..819 | CDD:290150 | 12/65 (18%) | ||
| TPR repeat | 787..816 | CDD:276809 | 5/28 (18%) | ||
| TPR_11 | 821..887 | CDD:290150 | 11/38 (29%) | ||
| TPR repeat | 822..850 | CDD:276809 | 4/27 (15%) | ||
| TPR repeat | 855..885 | CDD:276809 | 2/4 (50%) | ||
| TPR_11 | <874..921 | CDD:290150 | |||
| TPR repeat | 890..918 | CDD:276809 | |||
| ifit14 | NP_001287802.1 | TPR_12 | 47..120 | CDD:290160 | 22/76 (29%) |
| TPR repeat | 248..272 | CDD:276809 | |||
| TPR repeat | 277..319 | CDD:276809 | |||
| TPR repeat | 324..352 | CDD:276809 | |||
| TPR repeat | 358..392 | CDD:276809 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E2759_KOG1124 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.810 | |||||