Sequence 1: | NP_608558.1 | Gene: | CG4341 / 33276 | FlyBaseID: | FBgn0028481 | Length: | 938 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001070789.1 | Gene: | spag1b / 768178 | ZFINID: | ZDB-GENE-061013-512 | Length: | 591 | Species: | Danio rerio |
Alignment Length: | 240 | Identity: | 53/240 - (22%) |
---|---|---|---|
Similarity: | 87/240 - (36%) | Gaps: | 84/240 - (35%) |
- Green bases have known domain annotations that are detailed below.
Fly 702 AAVRDRTAHDQA-RSSAYLQLGALYVEQGKLQRALAIYREALSSLPGLPQQREILYQRIGDVLGR 765
Fly 766 LQQWDEAERHHRAALELQPNQVAAHLSYGITLARNSSRASEAEMWFKRALKLAPEQASVYHHYAE 830
Fly 831 FLSLQSRHHESAIYHRRAAELAPNDYTLVVAAA-------------TAMRLLDRKVDAEMWYRKA 882
Fly 883 VALRPGDAHAHT-NLGAILHLLGRTNHAAASYKAALRLQPGDAIT 926 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG4341 | NP_608558.1 | PMT_2 | 112..>232 | CDD:304453 | |
DUF1736 | 275..343 | CDD:285594 | |||
TPR_11 | 602..667 | CDD:290150 | |||
TPR_1 | 602..634 | CDD:278916 | |||
TPR repeat | 602..630 | CDD:276809 | |||
TPR repeat | 635..665 | CDD:276809 | |||
TPR_11 | 636..700 | CDD:290150 | |||
TPR_1 | 636..668 | CDD:278916 | |||
TPR repeat | 670..694 | CDD:276809 | |||
TPR_11 | 714..784 | CDD:290150 | 20/69 (29%) | ||
TPR repeat | 715..743 | CDD:276809 | 5/27 (19%) | ||
TPR repeat | 748..782 | CDD:276809 | 11/33 (33%) | ||
TPR_11 | 755..819 | CDD:290150 | 14/63 (22%) | ||
TPR repeat | 787..816 | CDD:276809 | 2/28 (7%) | ||
TPR_11 | 821..887 | CDD:290150 | 15/78 (19%) | ||
TPR repeat | 822..850 | CDD:276809 | 7/27 (26%) | ||
TPR repeat | 855..885 | CDD:276809 | 7/42 (17%) | ||
TPR_11 | <874..921 | CDD:290150 | 8/47 (17%) | ||
TPR repeat | 890..918 | CDD:276809 | 7/28 (25%) | ||
spag1b | NP_001070789.1 | TPR_11 | 194..258 | CDD:290150 | 23/81 (28%) |
TPR repeat | 198..222 | CDD:276809 | 7/36 (19%) | ||
TPR repeat | 226..256 | CDD:276809 | 10/30 (33%) | ||
TPR_16 | 233..294 | CDD:290168 | 22/96 (23%) | ||
TPR repeat | 261..289 | CDD:276809 | 9/62 (15%) | ||
TPR repeat | 483..513 | CDD:276809 | |||
TPR_11 | 486..548 | CDD:290150 | |||
TPR_1 | 486..517 | CDD:278916 | |||
TPR repeat | 518..546 | CDD:276809 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG1124 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |