DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4341 and Lonrf3

DIOPT Version :9

Sequence 1:NP_608558.1 Gene:CG4341 / 33276 FlyBaseID:FBgn0028481 Length:938 Species:Drosophila melanogaster
Sequence 2:XP_006541467.1 Gene:Lonrf3 / 74365 MGIID:1921615 Length:805 Species:Mus musculus


Alignment Length:356 Identity:72/356 - (20%)
Similarity:119/356 - (33%) Gaps:98/356 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   543 CLLVGYGVSKLMSCNQRTRN--------ILLLSFSLLLAAMSLRTLRRNADWRDEESLYRSAIAI 599
            |.|.|..:|.||:.:.|.|.        .|.|..:::|:.:                  ...:..
Mouse   193 CALCGVKLSALMAASGRARGPRRAGQPAPLQLRVNVVLSGL------------------LGKLFP 239

  Fly   600 NPPKA--LGNLGSVLSSQGRYEEAKQVLQEAIRFRPNMADVHFNLGILHQNQQVYPAAVECFQRA 662
            .|.:|  |.:.|:.|..:.:.|.|.....||:|..||...::.|...::...:.:..|:...:.|
Mouse   240 GPARASQLRHEGNRLFREHQVEAALLKYNEAVRLAPNDHLLYSNRSQIYFTLESHEDALHDAEIA 304

  Fly   663 IKFRPNLAVAYLNLGISFIALGKRQQAIEILQAGSNLDGAAVRDRTAHDQARSSAYLQLGALYVE 727
            .|.||....|:.....:...|||.::|::......:|||       .:..|||.|          
Mouse   305 CKLRPMGFKAHFRKAQALATLGKVKEALKEFLYCVSLDG-------KNKSARSEA---------- 352

  Fly   728 QGKLQRALAIYREALSSLPGLPQQREILYQRIGDVLGRLQQWDEAERHHRAALELQPNQVAAHLS 792
                ||.|..:..  .|:||..|:..      .|:|..|......:.|    :|....:..:|  
Mouse   353 ----QRLLFSFFS--PSVPGESQEHS------PDILKLLAPHPRLKEH----VESMATEGTSH-- 399

  Fly   793 YGITLARNSSRASEAEMWFKRALKLAPEQASVYHHYAEFLSLQSRHHESAIYHRRAAELAPNDYT 857
                                ...||:.|...:.|         ..:.|.|.....::.||.:   
Mouse   400 --------------------NLPKLSQENLELPH---------CSNQEGAAAAEESSSLANS--- 432

  Fly   858 LVVAAATAMRLLDRKVDAEMWYRKAVALRPG 888
               |........|||.|.|...|.|.::|.|
Mouse   433 ---AQGKVSSKEDRKKDQEGEDRDAASVRTG 460

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4341NP_608558.1 PMT_2 112..>232 CDD:304453
DUF1736 275..343 CDD:285594
TPR_11 602..667 CDD:290150 15/66 (23%)
TPR_1 602..634 CDD:278916 9/33 (27%)
TPR repeat 602..630 CDD:276809 8/29 (28%)
TPR repeat 635..665 CDD:276809 3/29 (10%)
TPR_11 636..700 CDD:290150 11/63 (17%)
TPR_1 636..668 CDD:278916 5/31 (16%)
TPR repeat 670..694 CDD:276809 5/23 (22%)
TPR_11 714..784 CDD:290150 15/69 (22%)
TPR repeat 715..743 CDD:276809 5/27 (19%)
TPR repeat 748..782 CDD:276809 5/33 (15%)
TPR_11 755..819 CDD:290150 8/63 (13%)
TPR repeat 787..816 CDD:276809 1/28 (4%)
TPR_11 821..887 CDD:290150 13/65 (20%)
TPR repeat 822..850 CDD:276809 3/27 (11%)
TPR repeat 855..885 CDD:276809 8/29 (28%)
TPR_11 <874..921 CDD:290150 6/15 (40%)
TPR repeat 890..918 CDD:276809
Lonrf3XP_006541467.1 RING1-HC_LONFs 159..197 CDD:319427 2/3 (67%)
3a0801s09 <244..>359 CDD:273380 32/135 (24%)
TPR repeat 244..272 CDD:276809 8/27 (30%)
TPR repeat 277..307 CDD:276809 3/29 (10%)
TPR repeat 312..335 CDD:276809 5/22 (23%)
PEX10 <456..551 CDD:227861 2/5 (40%)
RING2-HC_LONFs 510..551 CDD:319428
LON_substr_bdg 601..802 CDD:366967
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1124
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.