DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4341 and KDM6A

DIOPT Version :9

Sequence 1:NP_608558.1 Gene:CG4341 / 33276 FlyBaseID:FBgn0028481 Length:938 Species:Drosophila melanogaster
Sequence 2:XP_011542260.1 Gene:KDM6A / 7403 HGNCID:12637 Length:1489 Species:Homo sapiens


Alignment Length:362 Identity:73/362 - (20%)
Similarity:133/362 - (36%) Gaps:81/362 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   603 KALGNLGSVLSSQGRYEE----AKQVLQEAIRFRPNM---------ADVHFNLGILHQNQQVYPA 654
            :|||.|.|.|....|:.|    .|.:|.:|:|...::         :|....||..:...:.||.
Human    47 EALGGLDSRLFGFVRFHEDGARTKALLGKAVRCYESLILKAEGKVESDFFCQLGHFNLLLEDYPK 111

  Fly   655 AVECFQRAIKFRPNLAVAYLNLGISFIALGKRQQAIEILQAGSNLDGAAVRDRTAHDQARSSAYL 719
            |:..:||           |.:|                                ..|..:::|:|
Human   112 ALSAYQR-----------YYSL--------------------------------QSDYWKNAAFL 133

  Fly   720 Q-LGALYVEQGKLQRALAIYREALSSLPGLPQQREILYQRIGDVLGRLQQWDEAERHHRAAL--- 780
            . ||.:|......|.|:..::|.|...|...:.:|| :.|:|.:......::.:.:|.:.||   
Human   134 YGLGLVYFHYNAFQWAIKAFQEVLYVDPSFCRAKEI-HLRLGLMFKVNTDYESSLKHFQLALVDC 197

  Fly   781 ---ELQPNQVAAHLSYGITLARNSSRASEAEMWFKRALKLAPEQASV----------YHHYAEFL 832
               .|...::..|:::.....|....|.||   :::.|:.....|.|          .||..:.|
Human   198 NPCTLSNAEIQFHIAHLYETQRKYHSAKEA---YEQLLQTENLSAQVKATVLQQLGWMHHTVDLL 259

  Fly   833 SLQSRHHESAI-YHRRAAELAPNDYTLVVAAATAMRLLDRKVDAEMWYRKAVALRPGDAHAHTNL 896
            ..::.....|| |.:::.|..||..............:.:..||.:.||:::......|....::
Human   260 GDKATKESYAIQYLQKSLEADPNSGQSWYFLGRCYSSIGKVQDAFISYRQSIDKSEASADTWCSI 324

  Fly   897 GAILHLLGRTNHAAASYKAALRLQPGDA---ITLGNL 930
            |.:.....:...|..:|..|::|..|.|   :.||.|
Human   325 GVLYQQQNQPMDALQAYICAVQLDHGHAAAWMDLGTL 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4341NP_608558.1 PMT_2 112..>232 CDD:304453
DUF1736 275..343 CDD:285594
TPR_11 602..667 CDD:290150 20/76 (26%)
TPR_1 602..634 CDD:278916 12/34 (35%)
TPR repeat 602..630 CDD:276809 11/30 (37%)
TPR repeat 635..665 CDD:276809 8/38 (21%)
TPR_11 636..700 CDD:290150 10/63 (16%)
TPR_1 636..668 CDD:278916 8/31 (26%)
TPR repeat 670..694 CDD:276809 2/23 (9%)
TPR_11 714..784 CDD:290150 18/76 (24%)
TPR repeat 715..743 CDD:276809 8/28 (29%)
TPR repeat 748..782 CDD:276809 7/39 (18%)
TPR_11 755..819 CDD:290150 12/69 (17%)
TPR repeat 787..816 CDD:276809 5/28 (18%)
TPR_11 821..887 CDD:290150 15/76 (20%)
TPR repeat 822..850 CDD:276809 8/38 (21%)
TPR repeat 855..885 CDD:276809 4/29 (14%)
TPR_11 <874..921 CDD:290150 10/46 (22%)
TPR repeat 890..918 CDD:276809 5/27 (19%)
KDM6AXP_011542260.1 TPR repeat 93..121 CDD:276809 9/38 (24%)
TPR 106..399 CDD:223533 58/303 (19%)
TPR repeat 129..159 CDD:276809 9/29 (31%)
TPR_1 130..163 CDD:278916 10/32 (31%)
TPR repeat 164..194 CDD:276809 5/30 (17%)
TPR repeat 205..233 CDD:276809 5/30 (17%)
TPR repeat 243..278 CDD:276809 6/34 (18%)
TPR_17 272..303 CDD:290167 4/30 (13%)
TPR repeat 285..312 CDD:276809 4/26 (15%)
TPR repeat 317..347 CDD:276809 5/29 (17%)
TPR_1 318..351 CDD:278916 6/32 (19%)
TPR repeat 352..378 CDD:276809 4/10 (40%)
JmjC 1151..1215 CDD:214721
JmjC 1185..1293 CDD:202224
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1124
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.