DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tmtc2 and Ttc6

DIOPT Version :10

Sequence 1:NP_608558.1 Gene:Tmtc2 / 33276 FlyBaseID:FBgn0028481 Length:938 Species:Drosophila melanogaster
Sequence 2:NP_001299573.1 Gene:Ttc6 / 70846 MGIID:2684915 Length:1857 Species:Mus musculus


Alignment Length:351 Identity:76/351 - (21%)
Similarity:132/351 - (37%) Gaps:29/351 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   593 YRSAIAINPPKALGNLGSV--LSSQGRYEEAKQVLQEAIRFRPNMADVHFNLGILHQNQQVYPAA 655
            :..|:.:||......|..|  ...:|||.:|.....|||:..|.....:...|:|....:.|...
Mouse  1397 FNRALTLNPKHYQAYLSRVAYYGLKGRYSKAILNCNEAIKLYPESVRAYICRGVLKYYNRTYKLG 1461

  Fly   656 VECFQRAIKFRPNLAVAYLNLGISFIALGKRQQAIE------ILQAGSNLDGAAVRDRTAHDQAR 714
            :.....|||...|...||.|..:.:..:|:.|.|:.      :|.||.|:              .
Mouse  1462 ITDLSTAIKMDKNNYTAYYNRALCYTKIGEHQMALRDYGIVLLLDAGENI--------------A 1512

  Fly   715 SSAYLQLGALYVEQGKLQRALAIYREALSSLPGLPQQREILYQRIGDVLGRLQQWDEAERHHRAA 779
            .:..:..|.:|.|..:...||..:::| :.:.|....   |.|.......|:::::.|......|
Mouse  1513 LNTLINRGLIYTELKQYGFALEDFKQA-ALMSGTSVS---LCQATATCHHRIKEFEGAVEFFTRA 1573

  Fly   780 LELQPNQVAAHLSYGITLARNSSRAS--EAEMWFKRALKLAPEQASVYHHYAEFLSLQSRHHESA 842
            :::.|:.|.|::..|.:....|...:  :|:..|.:||.|.|............|..|.:..::.
Mouse  1574 IKINPHYVDAYIGRGNSYMEYSQEDAMIQAQKDFLKALHLDPSCLKARISLGYNLQAQGKFQKAW 1638

  Fly   843 IYHRRAAELAPNDYTLVVAAATAMRLLDRKVDAEMWYRKAVALRPGDAHAHTNLGAILHLLGRTN 907
            |:.....|..|..|......|.....:.....|......|:.:. ..|...||.|.|...:|:..
Mouse  1639 IHFTVGIESNPKSYLAYEGRAVVCLQMSNYFAAMQDINCAIKIN-STAEFLTNRGVIHEFMGQQQ 1702

  Fly   908 HAAASYKAALRLQPGDAITLGNLAKL 933
            .|.|.|:||:.|.|..::...|...:
Mouse  1703 SAMADYQAAISLNPSYSLAYFNAGNI 1728

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tmtc2NP_608558.1 TMTC_DUF1736 270..343 CDD:462468
TPR 597..852 CDD:440225 56/264 (21%)
TPR repeat 602..630 CDD:276809 8/29 (28%)
TPR repeat 635..665 CDD:276809 5/29 (17%)
TPR repeat 670..694 CDD:276809 6/29 (21%)
TPR repeat 715..743 CDD:276809 6/27 (22%)
TPR repeat 748..782 CDD:276809 5/33 (15%)
TPR 780..>933 CDD:440225 34/154 (22%)
TPR repeat 787..816 CDD:276809 7/30 (23%)
TPR repeat 822..850 CDD:276809 3/27 (11%)
TPR repeat 855..885 CDD:276809 4/29 (14%)
TPR repeat 890..918 CDD:276809 11/27 (41%)
Ttc6NP_001299573.1 PTZ00436 <13..178 CDD:185616
TPR repeat 889..917 CDD:276809
PEP_TPR_lipo 896..1760 CDD:274350 76/351 (22%)
TPR repeat 922..952 CDD:276809
TPR repeat 957..984 CDD:276809
TPR repeat 990..1017 CDD:276809
TPR repeat 1023..1051 CDD:276809
TPR repeat 1056..1086 CDD:276809
TPR repeat 1162..1189 CDD:276809
TPR repeat 1194..1224 CDD:276809
TPR repeat 1229..1257 CDD:276809
TPR repeat 1268..1292 CDD:276809
TPR repeat 1299..1325 CDD:276809
TPR repeat 1341..1369 CDD:276809
TPR repeat 1374..1403 CDD:276809 1/5 (20%)
TadD <1398..1506 CDD:444034 26/107 (24%)
TPR repeat 1408..1436 CDD:276809 8/27 (30%)
TPR repeat 1441..1471 CDD:276809 5/29 (17%)
TPR repeat 1476..1499 CDD:276809 6/22 (27%)
TPR repeat 1515..1541 CDD:276809 6/26 (23%)
TPR repeat 1546..1576 CDD:276809 5/32 (16%)
TPR repeat 1581..1611 CDD:276809 6/29 (21%)
TPR repeat 1619..1646 CDD:276809 3/26 (12%)
TPR repeat 1651..1681 CDD:276809 4/29 (14%)
TPR 1685..>1852 CDD:440225 14/44 (32%)
TPR repeat 1685..1713 CDD:276809 11/27 (41%)
TPR repeat 1718..1748 CDD:276809 1/11 (9%)
TPR repeat 1753..1781 CDD:276809
TPR repeat 1787..1810 CDD:276809
TPR repeat 1821..1849 CDD:276809
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.