DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4341 and Ttc32

DIOPT Version :9

Sequence 1:NP_608558.1 Gene:CG4341 / 33276 FlyBaseID:FBgn0028481 Length:938 Species:Drosophila melanogaster
Sequence 2:XP_003750178.1 Gene:Ttc32 / 684830 RGDID:1585566 Length:148 Species:Rattus norvegicus


Alignment Length:132 Identity:28/132 - (21%)
Similarity:56/132 - (42%) Gaps:20/132 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   573 AAMSLRTLR-RNADWRDEESLYRSAIA--------INPPKALGNLGSVLSSQGR-------YEEA 621
            ||:::...| ...|:.:...||.:.|.        .:|.    :|.:..:::|:       :.||
  Rat    14 AALAMAQARFARGDFTEARELYSAFIGQCASHRSKCSPE----DLATAYNNRGQTKYFSVDFYEA 74

  Fly   622 KQVLQEAIRFRPNMADVHFNLGILHQNQQVYPAAVECFQRAIKFRPNLAVAYLNLGISFIALGKR 686
            ......||...||....::|.|::......:..|||.|::|:...|....|.|:|..:.:...::
  Rat    75 MDDYTSAIEILPNFEVPYYNRGLIRYRLGYFDEAVEDFKKALDRNPAFQDAVLSLKQTILDKEEK 139

  Fly   687 QQ 688
            |:
  Rat   140 QR 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4341NP_608558.1 PMT_2 112..>232 CDD:304453
DUF1736 275..343 CDD:285594
TPR_11 602..667 CDD:290150 15/71 (21%)
TPR_1 602..634 CDD:278916 6/38 (16%)
TPR repeat 602..630 CDD:276809 5/34 (15%)
TPR repeat 635..665 CDD:276809 7/29 (24%)
TPR_11 636..700 CDD:290150 12/53 (23%)
TPR_1 636..668 CDD:278916 7/31 (23%)
TPR repeat 670..694 CDD:276809 4/19 (21%)
TPR_11 714..784 CDD:290150
TPR repeat 715..743 CDD:276809
TPR repeat 748..782 CDD:276809
TPR_11 755..819 CDD:290150
TPR repeat 787..816 CDD:276809
TPR_11 821..887 CDD:290150
TPR repeat 822..850 CDD:276809
TPR repeat 855..885 CDD:276809
TPR_11 <874..921 CDD:290150
TPR repeat 890..918 CDD:276809
Ttc32XP_003750178.1 TPR_11 14..86 CDD:290150 14/75 (19%)
TPR repeat 14..48 CDD:276809 7/33 (21%)
TPR repeat 53..84 CDD:276809 6/30 (20%)
TPR_11 55..120 CDD:290150 14/64 (22%)
TPR_1 55..88 CDD:278916 6/32 (19%)
TPR repeat 89..117 CDD:276809 7/27 (26%)
TPR_1 92..120 CDD:278916 7/27 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1124
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.