| Sequence 1: | NP_608558.1 | Gene: | CG4341 / 33276 | FlyBaseID: | FBgn0028481 | Length: | 938 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_080590.3 | Gene: | Dnaaf4 / 67685 | MGIID: | 1914935 | Length: | 420 | Species: | Mus musculus |
| Alignment Length: | 196 | Identity: | 47/196 - (23%) |
|---|---|---|---|
| Similarity: | 76/196 - (38%) | Gaps: | 39/196 - (19%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 559 RTRNILLLSFSLLLAAMSLR--TLRRNADWRDEESLYRSAIAINPPKALGNLGSVLSSQGRYEEA 621
Fly 622 KQVLQEAIRFRPNMADVHFNLGILHQNQQVYPAAVECFQRAIKFRPNLAVAYLNLGISFIALGKR 686
Fly 687 QQAIEILQAGSNL------DGAAVRDRTAHDQARSSAYLQLGALYVEQGKLQRALAIYREALSSL 745
Fly 746 P 746 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG4341 | NP_608558.1 | PMT_2 | 112..>232 | CDD:304453 | |
| DUF1736 | 275..343 | CDD:285594 | |||
| TPR_11 | 602..667 | CDD:290150 | 13/64 (20%) | ||
| TPR_1 | 602..634 | CDD:278916 | 4/31 (13%) | ||
| TPR repeat | 602..630 | CDD:276809 | 3/27 (11%) | ||
| TPR repeat | 635..665 | CDD:276809 | 8/29 (28%) | ||
| TPR_11 | 636..700 | CDD:290150 | 16/69 (23%) | ||
| TPR_1 | 636..668 | CDD:278916 | 8/31 (26%) | ||
| TPR repeat | 670..694 | CDD:276809 | 7/23 (30%) | ||
| TPR_11 | 714..784 | CDD:290150 | 13/33 (39%) | ||
| TPR repeat | 715..743 | CDD:276809 | 10/27 (37%) | ||
| TPR repeat | 748..782 | CDD:276809 | |||
| TPR_11 | 755..819 | CDD:290150 | |||
| TPR repeat | 787..816 | CDD:276809 | |||
| TPR_11 | 821..887 | CDD:290150 | |||
| TPR repeat | 822..850 | CDD:276809 | |||
| TPR repeat | 855..885 | CDD:276809 | |||
| TPR_11 | <874..921 | CDD:290150 | |||
| TPR repeat | 890..918 | CDD:276809 | |||
| Dnaaf4 | NP_080590.3 | Mediates interaction with ESR1 and STUB1. /evidence=ECO:0000250 | 7..103 | ||
| p23_DYX1C1_like | 10..87 | CDD:107226 | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 164..212 | ||||
| TPR_11 | 287..351 | CDD:290150 | 16/66 (24%) | ||
| TPR 1 | 288..321 | 9/35 (26%) | |||
| TPR repeat | 288..316 | CDD:276809 | 8/30 (27%) | ||
| TPR repeat | 321..351 | CDD:276809 | 7/29 (24%) | ||
| TPR 2 | 322..355 | 8/32 (25%) | |||
| TPR_1 | 322..351 | CDD:278916 | 7/28 (25%) | ||
| TPR_12 | 324..396 | CDD:290160 | 26/81 (32%) | ||
| TPR repeat | 362..392 | CDD:276809 | 14/38 (37%) | ||
| TPR 3 | 364..397 | 15/41 (37%) | |||
| TPR_1 | 365..397 | CDD:278916 | 15/40 (38%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E2759_KOG1124 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||