DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tmtc2 and Tomm34

DIOPT Version :10

Sequence 1:NP_608558.1 Gene:Tmtc2 / 33276 FlyBaseID:FBgn0028481 Length:938 Species:Drosophila melanogaster
Sequence 2:NP_080272.1 Gene:Tomm34 / 67145 MGIID:1914395 Length:309 Species:Mus musculus


Alignment Length:204 Identity:40/204 - (19%)
Similarity:74/204 - (36%) Gaps:37/204 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   561 RNILLLSFSLLLAAMSLRTLRR------NADWRDEESLYRSAIAINPPKALGNLGSVLSSQGRYE 619
            :.:|.:..|:..|...:..:.|      ..:||    |....|.:.|..|.....| |.|....|
Mouse   109 KTVLQIDNSVASALEGINRITRALMDSLGPEWR----LKLPPIPVVPVSAQKRWNS-LPSDNHKE 168

  Fly   620 EAKQVLQEAIRFR---PNMADVHFNLGILHQNQQV-----YPAAVECFQRAIKFRPNLAVAYLNL 676
            .||...:||...:   |:..||.....:..:...:     :..|:|.:..::......:..|.|.
Mouse   169 TAKTKSKEATATKSRVPSAGDVERAKALKEEGNDLVKKGNHKKAIEKYSESLLCSSLESATYSNR 233

  Fly   677 GISFIALGKRQQAIEILQAGSNLDGAAVRDRTAHDQARSSAYLQLGALYVEQGKLQRALAIYREA 741
            .:..:.|.:.::|::.......|||..|:                 |.| .:.:..:||..|:.:
Mouse   234 ALCHLVLKQYKEAVKDCTEALKLDGKNVK-----------------AFY-RRAQAYKALKDYKSS 280

  Fly   742 LSSLPGLPQ 750
            ||.:..|.|
Mouse   281 LSDISSLLQ 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tmtc2NP_608558.1 TMTC_DUF1736 270..343 CDD:462468
TPR 597..852 CDD:440225 33/162 (20%)
TPR repeat 602..630 CDD:276809 9/27 (33%)
TPR repeat 635..665 CDD:276809 4/34 (12%)
TPR repeat 670..694 CDD:276809 4/23 (17%)
TPR repeat 715..743 CDD:276809 5/27 (19%)
TPR repeat 748..782 CDD:276809 2/3 (67%)
TPR 780..>933 CDD:440225
TPR repeat 787..816 CDD:276809
TPR repeat 822..850 CDD:276809
TPR repeat 855..885 CDD:276809
TPR repeat 890..918 CDD:276809
Tomm34NP_080272.1 TPR 1 9..42
TPR repeat 9..37 CDD:276809
3a0801s09 <12..>294 CDD:273380 40/204 (20%)
TPR repeat 50..80 CDD:276809
TPR 2 51..84
TPR 3 85..118 1/8 (13%)
TPR repeat 85..113 CDD:276809 0/3 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 158..189 9/31 (29%)
TPR 4 193..226 2/32 (6%)
TPR repeat 193..221 CDD:276809 2/27 (7%)
TPR repeat 226..256 CDD:276809 4/29 (14%)
TPR 5 227..260 7/32 (22%)
TPR 6 261..294 10/47 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.