DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tmtc2 and Ifit3b

DIOPT Version :10

Sequence 1:NP_608558.1 Gene:Tmtc2 / 33276 FlyBaseID:FBgn0028481 Length:938 Species:Drosophila melanogaster
Sequence 2:XP_006527327.1 Gene:Ifit3b / 667370 MGIID:3698419 Length:428 Species:Mus musculus


Alignment Length:265 Identity:60/265 - (22%)
Similarity:105/265 - (39%) Gaps:63/265 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   616 GRYEEAKQVLQEAIRFRP-------NMADVHFNLGILHQNQQVYPAAVECFQRAIKFRP-NLAVA 672
            ||.|.||...::|:..:|       .||...|.|....:.|    .:|:..::|::..| |..|.
Mouse   175 GRNERAKMCFEKALEEKPKDPECSSGMAIAMFRLEEKPEKQ----FSVDALKQAMELNPQNQYVK 235

  Fly   673 YLNLGISFIALGKRQQAIEILQAGSNLDG-AAVRDRTAHDQARSSAYLQLGALYVEQGKLQRALA 736
            .|             .|:::|:.|...:| ..::|.......::....:....|.::|.|.||:.
Mouse   236 VL-------------LALKLLRMGEEAEGERLIKDALGKAPNQTDVLQKAAQFYKKKGNLDRAIE 287

  Fly   737 IYREALSSLPGLPQQREILYQRIGDVLGRLQ---QWDEAERHHRAA----LELQPNQVAAHLSYG 794
            :..:||.|.........::..|..::|.:||   ..|.:||..|.|    |.::..|.       
Mouse   288 LLGKALRSTVNNSPLYSLVMCRYREILEQLQNKGDADSSERRQRMAELRRLTMEFMQK------- 345

  Fly   795 ITLARNSSRAS---------EAEMWFKRAL-KLAP--EQASVYHHYAEFLSLQSRHHESAIYHRR 847
             ||.|..|..:         |.|..::..: |.:|  |:..:|..|.   :||.       |||:
Mouse   346 -TLQRRRSPLNSYSDLIDFPEVERCYQMVISKESPDVEEEDLYERYC---NLQE-------YHRK 399

  Fly   848 AAELA 852
            :.:||
Mouse   400 SEDLA 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tmtc2NP_608558.1 TMTC_DUF1736 270..343 CDD:462468
TPR 597..852 CDD:440225 58/263 (22%)
TPR repeat 602..630 CDD:276809 6/13 (46%)
TPR repeat 635..665 CDD:276809 7/29 (24%)
TPR repeat 670..694 CDD:276809 3/23 (13%)
TPR repeat 715..743 CDD:276809 6/27 (22%)
TPR repeat 748..782 CDD:276809 10/40 (25%)
TPR 780..>933 CDD:440225 20/85 (24%)
TPR repeat 787..816 CDD:276809 6/38 (16%)
TPR repeat 822..850 CDD:276809 7/27 (26%)
TPR repeat 855..885 CDD:276809
TPR repeat 890..918 CDD:276809
Ifit3bXP_006527327.1 TPR_12 76..151 CDD:315987
TPR repeat 76..104 CDD:276809
TPR repeat 109..148 CDD:276809
TPR 121..362 CDD:440225 46/211 (22%)
TPR repeat 161..189 CDD:276809 6/13 (46%)
TPR repeat 194..227 CDD:276809 7/36 (19%)
TPR repeat 266..294 CDD:276809 6/27 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.