| Sequence 1: | NP_608558.1 | Gene: | CG4341 / 33276 | FlyBaseID: | FBgn0028481 | Length: | 938 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001032654.1 | Gene: | ifit8 / 641567 | ZFINID: | ZDB-GENE-051127-17 | Length: | 429 | Species: | Danio rerio |
| Alignment Length: | 395 | Identity: | 83/395 - (21%) |
|---|---|---|---|
| Similarity: | 131/395 - (33%) | Gaps: | 133/395 - (33%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 639 HFNLGILHQNQQVYPAAVECFQR-AIK--FRPNLAVAYLNLGISFIALGKRQQAIEILQAGSNLD 700
Fly 701 GAAVRDRTAHDQARSSAYLQLGAL---------------YVEQGKLQRALAIYREALSSLPGLPQ 750
Fly 751 QREIL--------------YQRIGDV-LGRLQ------QWD-------------EAERHHRA--- 778
Fly 779 ----------ALELQPNQVAAHLSYGITLARNSSRASEAEMWFKRALKLAPEQASVYHHYAEFLS 833
Fly 834 LQ--------------------SR-HHESA----------------------IYH-RRAAELAPN 854
Fly 855 DYTLVVAAATAMRLLDRKVDAEMWYRKAVA---LRPGDAHA-HTNLGAI-LHLLGRTNHAAASYK 914
Fly 915 AALRL 919 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG4341 | NP_608558.1 | PMT_2 | 112..>232 | CDD:304453 | |
| DUF1736 | 275..343 | CDD:285594 | |||
| TPR_11 | 602..667 | CDD:290150 | 7/30 (23%) | ||
| TPR_1 | 602..634 | CDD:278916 | |||
| TPR repeat | 602..630 | CDD:276809 | |||
| TPR repeat | 635..665 | CDD:276809 | 7/28 (25%) | ||
| TPR_11 | 636..700 | CDD:290150 | 17/63 (27%) | ||
| TPR_1 | 636..668 | CDD:278916 | 7/31 (23%) | ||
| TPR repeat | 670..694 | CDD:276809 | 6/23 (26%) | ||
| TPR_11 | 714..784 | CDD:290150 | 21/131 (16%) | ||
| TPR repeat | 715..743 | CDD:276809 | 5/42 (12%) | ||
| TPR repeat | 748..782 | CDD:276809 | 13/80 (16%) | ||
| TPR_11 | 755..819 | CDD:290150 | 21/110 (19%) | ||
| TPR repeat | 787..816 | CDD:276809 | 6/28 (21%) | ||
| TPR_11 | 821..887 | CDD:290150 | 20/112 (18%) | ||
| TPR repeat | 822..850 | CDD:276809 | 12/71 (17%) | ||
| TPR repeat | 855..885 | CDD:276809 | 4/32 (13%) | ||
| TPR_11 | <874..921 | CDD:290150 | 15/51 (29%) | ||
| TPR repeat | 890..918 | CDD:276809 | 9/29 (31%) | ||
| ifit8 | NP_001032654.1 | TPR_12 | 50..117 | CDD:290160 | 16/84 (19%) |
| TPR repeat | 206..236 | CDD:276809 | 7/30 (23%) | ||
| TPR repeat | 241..269 | CDD:276809 | 5/27 (19%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E2759_KOG1124 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.810 | |||||