DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4341 and ifit12

DIOPT Version :9

Sequence 1:NP_608558.1 Gene:CG4341 / 33276 FlyBaseID:FBgn0028481 Length:938 Species:Drosophila melanogaster
Sequence 2:NP_001177394.1 Gene:ifit12 / 567504 ZFINID:ZDB-GENE-120406-2 Length:474 Species:Danio rerio


Alignment Length:334 Identity:78/334 - (23%)
Similarity:135/334 - (40%) Gaps:56/334 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   602 PKALGNLG--SVLSSQGRYEEAKQVLQEAIRFRPNMADVHFNLG---ILHQNQQVYP-------A 654
            |:.||..|  .:..|:..|::|.:|.|:|:...|..::  :|.|   .|::.:...|       .
Zfish   139 PEVLGEKGWTYLKFSRKYYDKAVEVFQKAVELDPTNSE--WNAGYAIALYRTENFNPPPCTVETP 201

  Fly   655 AVECFQRAIKFRPNLAVAYLNLGISFIALGKRQQAIEILQAGSNLDGAAVRDRTAHDQARSSAYL 719
            |::..::||...|:..|..:.|||..:...|     .::.....|...|:.....|..    ...
Zfish   202 AIKQLRQAIDLNPDDDVLRVILGIKLLNCSK-----GLMNESEQLVEKALNQSPEHPH----VIR 257

  Fly   720 QLGALYVEQGKLQRALAIYREALSSLPG---LPQQREILYQ----RIGDVLGRLQQWDEAE---- 773
            .:|....:||.:.|::.|.::||...|.   :..|..:.|:    .:.....|..:.|||.    
Zfish   258 YVGMFLRDQGSVDRSIEILKKALQRSPKSGFICHQLAMCYKTKKINLCKEKRRKVEVDEARDQSI 322

  Fly   774 RHHRAALELQPNQVAA----HLSYGITLARNSSRASEAEMWFKRALKLAPEQ----ASVYHHYAE 830
            .:...|..|.|:.::|    .|.||     :.....:||..|.:|.||..|:    .||:..||:
Zfish   323 YYLEEATSLIPSFISAVCQLGLQYG-----DRRDLLKAEEQFDKAFKLVKEKNEHLQSVHLSYAQ 382

  Fly   831 FLSLQSRHHESAIYHRRAAELAPNDYTLVVAAATAMRLLDRKVDAEMWYRKAVALRPGDAHAHTN 895
            |....:|..:.||.|.... |..|.:| .....:|.:|.:..       :|.:.|.|.|..|:..
Zfish   383 FQQYSNRREDLAIEHYEKC-LTMNPHT-PDGNRSAQKLCNIA-------KKNLKLNPNDWKANEI 438

  Fly   896 LGAILHLLG 904
            ||.:.:|.|
Zfish   439 LGLVYNLKG 447

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4341NP_608558.1 PMT_2 112..>232 CDD:304453
DUF1736 275..343 CDD:285594
TPR_11 602..667 CDD:290150 18/76 (24%)
TPR_1 602..634 CDD:278916 10/33 (30%)
TPR repeat 602..630 CDD:276809 10/29 (34%)
TPR repeat 635..665 CDD:276809 7/39 (18%)
TPR_11 636..700 CDD:290150 13/73 (18%)
TPR_1 636..668 CDD:278916 7/41 (17%)
TPR repeat 670..694 CDD:276809 5/23 (22%)
TPR_11 714..784 CDD:290150 16/80 (20%)
TPR repeat 715..743 CDD:276809 6/27 (22%)
TPR repeat 748..782 CDD:276809 7/41 (17%)
TPR_11 755..819 CDD:290150 18/75 (24%)
TPR repeat 787..816 CDD:276809 8/32 (25%)
TPR_11 821..887 CDD:290150 16/69 (23%)
TPR repeat 822..850 CDD:276809 9/27 (33%)
TPR repeat 855..885 CDD:276809 4/29 (14%)
TPR_11 <874..921 CDD:290150 9/31 (29%)
TPR repeat 890..918 CDD:276809 5/15 (33%)
ifit12NP_001177394.1 TPR repeat 55..83 CDD:276809
TPR repeat 88..127 CDD:276809
TPR_12 97..172 CDD:290160 10/32 (31%)
TPR_2 139..174 CDD:285020 11/34 (32%)
TPR repeat 139..169 CDD:276809 10/29 (34%)
TPR repeat 174..212 CDD:276809 7/39 (18%)
TPR repeat 217..246 CDD:276809 6/33 (18%)
TPR repeat 286..331 CDD:276809 7/44 (16%)
TPR repeat 336..364 CDD:276809 8/32 (25%)
TPR repeat 374..402 CDD:276809 9/28 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1124
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.