DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4341 and ifit9

DIOPT Version :9

Sequence 1:NP_608558.1 Gene:CG4341 / 33276 FlyBaseID:FBgn0028481 Length:938 Species:Drosophila melanogaster
Sequence 2:NP_001315640.1 Gene:ifit9 / 567384 ZFINID:ZDB-GENE-121214-233 Length:474 Species:Danio rerio


Alignment Length:338 Identity:78/338 - (23%)
Similarity:130/338 - (38%) Gaps:72/338 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   605 LGNLGSVLSSQGRYEEAKQVLQEAIRFRP-NMADVHFN-LGILHQNQQVYPAAVECFQR---AIK 664
            :.:|.|:|          |.|.:.|||.| .....::| |..:...:.....|::..|:   |:|
Zfish    26 IADLNSIL----------QKLHDRIRFCPLKYHATYYNLLAFISHLEGKTDTALDYLQKAESALK 80

  Fly   665 FRPNLAVAYLNLGISFIALGKRQQAIEILQAGSN--------LDGAAVRDRT---AHDQARSSAY 718
            ........||....||..:....|.|...:...|        :.|::|...:   .|.: ::.::
Zfish    81 EDQRKETEYLVTFSSFAWIHYYLQRINDAEEYLNKVNGICKDIPGSSVYSCSLPIIHGE-KAWSF 144

  Fly   719 LQLGALYVEQGKLQRALAIYREALSSLPGLPQQREILYQRIGDVLGRLQQWDEAE------RHHR 777
            |:||..:.||.|     ..:.:||...|    ..|:.......||.||....:||      ...|
Zfish   145 LRLGRTFYEQAK-----ESFSKALKEEP----DNELFNVGYAIVLYRLHGMTQAEDPGKVIAQLR 200

  Fly   778 AALELQPNQVAAHLSYGITLARNSSRASEAEMWFKRALKLAPEQASVYHHYAEFLSLQSRHHESA 842
            .||.|:|  ..:.:...:.|....|:..||:...|.||:|:|:...|..:.|::...:....||.
Zfish   201 KALSLEP--ANSEIMVLLALKLQGSKRQEAQNLIKEALRLSPDVPQVTSYVAKYFRTEGNIEESL 263

  Fly   843 IYHRRAAELAPNDYTL------------------------VVAAATAMRLLDRKVDAEMWYRKAV 883
            ...:||.|||||...|                        :.||..|.::    .:...::.|||
Zfish   264 SVLKRAVELAPNSSFLHHQIGLCHKQQLIQMFEEKKHGSRISAAQKAAKV----SECIQYFSKAV 324

  Fly   884 ALRPGDAHAHTNL 896
            .|:|.:.:|..||
Zfish   325 ELKPNNIYAKVNL 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4341NP_608558.1 PMT_2 112..>232 CDD:304453
DUF1736 275..343 CDD:285594
TPR_11 602..667 CDD:290150 15/66 (23%)
TPR_1 602..634 CDD:278916 9/29 (31%)
TPR repeat 602..630 CDD:276809 5/24 (21%)
TPR repeat 635..665 CDD:276809 5/33 (15%)
TPR_11 636..700 CDD:290150 13/75 (17%)
TPR_1 636..668 CDD:278916 6/35 (17%)
TPR repeat 670..694 CDD:276809 6/23 (26%)
TPR_11 714..784 CDD:290150 20/75 (27%)
TPR repeat 715..743 CDD:276809 7/27 (26%)
TPR repeat 748..782 CDD:276809 10/39 (26%)
TPR_11 755..819 CDD:290150 19/69 (28%)
TPR repeat 787..816 CDD:276809 6/28 (21%)
TPR_11 821..887 CDD:290150 19/89 (21%)
TPR repeat 822..850 CDD:276809 6/27 (22%)
TPR repeat 855..885 CDD:276809 7/53 (13%)
TPR_11 <874..921 CDD:290150 8/23 (35%)
TPR repeat 890..918 CDD:276809 3/7 (43%)
ifit9NP_001315640.1 TPR_12 49..122 CDD:290160 13/72 (18%)
TPR repeat 49..84 CDD:276809 6/34 (18%)
TPR repeat 133..165 CDD:276809 9/37 (24%)
TPR_16 139..210 CDD:290168 21/82 (26%)
type_IV_pilW 210..>350 CDD:131573 32/132 (24%)
TPR repeat 210..237 CDD:276809 6/26 (23%)
TPR repeat 242..272 CDD:276809 6/29 (21%)
type_IV_pilW <322..472 CDD:131573 8/16 (50%)
TPR repeat 330..360 CDD:276809 3/8 (38%)
TPR repeat 369..398 CDD:276809
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.