DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4341 and IFIT1B

DIOPT Version :9

Sequence 1:NP_608558.1 Gene:CG4341 / 33276 FlyBaseID:FBgn0028481 Length:938 Species:Drosophila melanogaster
Sequence 2:NP_001010987.1 Gene:IFIT1B / 439996 HGNCID:23442 Length:474 Species:Homo sapiens


Alignment Length:396 Identity:73/396 - (18%)
Similarity:138/396 - (34%) Gaps:126/396 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   484 QCSSKDY---------ALEGMSPANRHACVLIMSLSFLALPFLPASNLLFYVGFVVAERLLYLPS 539
            :|..|:|         |||| :|.|                  |..|                  
Human   151 KCGGKNYERAKTCFEKALEG-NPEN------------------PEFN------------------ 178

  Fly   540 VGFCLLVGYGVSKLMSCNQRTRNILLLSFSLLLAAMSLRTLRRNADWRDEESLYRSAIAI----- 599
            .|:.:.| |.:.|..:.:.|.:            |.||..|:|......::...|..:|:     
Human   179 TGYAITV-YRLDKFNTASGRNK------------AFSLHVLKRAVRLNPDDVYIRVLLALKLQDE 230

  Fly   600 ----NPPKALGNLGSVLSSQ--------------GRYEEAKQVLQEAIRFRPNMADVHFNLGILH 646
                ...|.:....:.:|||              |..::|.::|:.|:...|..|.:|..:|:.:
Human   231 GQEAEGEKYIEEALTSISSQAYVFQYAAKFYRRKGSVDKALELLKMALETTPTSAFLHHQMGLCY 295

  Fly   647 QNQQV---------------------YPAAVECFQRAIKFRPNLAVAYLNLGISFIALGKRQQAI 690
            :.|.:                     ...|:..|::.|..:....:||::|..::..:|..::|.
Human   296 RAQMIQIKEATNWQPRGQDRETVDRLVQLAICKFEKTIMLKRTFEMAYVDLAETYAEIGHHRKAE 360

  Fly   691 EILQAGSNLDGAAVRDRTAHDQARSSAYLQLGALYVEQGKLQ-RALAIYREALSSLPGLPQQREI 754
            |..|.|       :|.:...||.:...:...|......||.| :|:..|.:.| .:..:...||.
Human   361 EHFQKG-------LRMKIFEDQLKQEIHYHYGRFQEHHGKSQDKAITHYLKGL-KIEKMSHSREK 417

  Fly   755 LYQRIGDVLGRLQQWDEAERHHRAALELQPNQVAAHLSYGITLARNSSRASEAEMWFKRALKLAP 819
            |       |..|::..:...|       |..:|...:|....:.:.....|:|.:.::|||:||.
Human   418 L-------LNALEKLAKRCIH-------QNVRVVESVSLLGLIHKLKGEVSDALLCYERALRLAA 468

  Fly   820 EQASVY 825
            :...::
Human   469 DLNPIF 474

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4341NP_608558.1 PMT_2 112..>232 CDD:304453
DUF1736 275..343 CDD:285594
TPR_11 602..667 CDD:290150 16/99 (16%)
TPR_1 602..634 CDD:278916 8/45 (18%)
TPR repeat 602..630 CDD:276809 8/41 (20%)
TPR repeat 635..665 CDD:276809 7/50 (14%)
TPR_11 636..700 CDD:290150 15/84 (18%)
TPR_1 636..668 CDD:278916 7/52 (13%)
TPR repeat 670..694 CDD:276809 6/23 (26%)
TPR_11 714..784 CDD:290150 13/70 (19%)
TPR repeat 715..743 CDD:276809 6/28 (21%)
TPR repeat 748..782 CDD:276809 6/33 (18%)
TPR_11 755..819 CDD:290150 13/63 (21%)
TPR repeat 787..816 CDD:276809 6/28 (21%)
TPR_11 821..887 CDD:290150 0/5 (0%)
TPR repeat 822..850 CDD:276809 0/4 (0%)
TPR repeat 855..885 CDD:276809
TPR_11 <874..921 CDD:290150
TPR repeat 890..918 CDD:276809
IFIT1BNP_001010987.1 TPR_11 36..>298 CDD:330823 35/196 (18%)
TPR 1 52..85
TPR repeat 54..80 CDD:276809
TPR 2 95..128
TPR repeat 97..123 CDD:276809
TPR repeat 128..170 CDD:276809 5/18 (28%)
TPR 3 139..174 8/23 (35%)
TPR 4 182..216 9/46 (20%)
TPR repeat 216..246 CDD:276809 3/29 (10%)
TPR 5 251..284 5/32 (16%)
TPR repeat 251..279 CDD:276809 4/27 (15%)
TPR repeat 284..335 CDD:276809 7/50 (14%)
TPR_11 <323..469 CDD:330823 37/167 (22%)
TPR 6 340..373 9/39 (23%)
TPR repeat 340..368 CDD:276809 8/34 (24%)
TPR 7 378..412 7/34 (21%)
TPR repeat 378..407 CDD:276809 7/29 (24%)
TPR 8 437..470 8/32 (25%)
TPR repeat 437..465 CDD:276809 5/27 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1124
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.