Sequence 1: | NP_608558.1 | Gene: | CG4341 / 33276 | FlyBaseID: | FBgn0028481 | Length: | 938 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_956610.1 | Gene: | odad4 / 393286 | ZFINID: | ZDB-GENE-040426-995 | Length: | 486 | Species: | Danio rerio |
Alignment Length: | 488 | Identity: | 93/488 - (19%) |
---|---|---|---|
Similarity: | 148/488 - (30%) | Gaps: | 208/488 - (42%) |
- Green bases have known domain annotations that are detailed below.
Fly 609 GSVLSSQGRYEEAKQVLQEAIRFRPN---------------------MADVHFNL--------GI 644
Fly 645 LHQNQQVYPA-----AVECFQRAIKFRPNLAVAYLNLGISFIALGKRQQAIE----------ILQ 694
Fly 695 AG-----------SNLDGAAVRDRTAH----DQARSSAYLQLGALYVEQGKLQRAL--------- 735
Fly 736 -----------------------------AIY-------------------------REALSSL- 745
Fly 746 ------------------------------PGLPQQREI---LYQRIGDVLGRLQQWDEAERHHR 777
Fly 778 AALE------LQPNQVAAHLSYGITLARNSSRASEAEMWFKRALKLA---PEQASVYHHYAE-FL 832
Fly 833 SLQSRHHESAIYHRRAAELAPNDYTLVVAAATAMRLLDRKVDAEMWYRKAVALRPGDAHAHTNL- 896
Fly 897 ---GAILHL--------LGRTNHAAASYKAALR 918 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG4341 | NP_608558.1 | PMT_2 | 112..>232 | CDD:304453 | |
DUF1736 | 275..343 | CDD:285594 | |||
TPR_11 | 602..667 | CDD:290150 | 14/91 (15%) | ||
TPR_1 | 602..634 | CDD:278916 | 6/24 (25%) | ||
TPR repeat | 602..630 | CDD:276809 | 6/20 (30%) | ||
TPR repeat | 635..665 | CDD:276809 | 6/42 (14%) | ||
TPR_11 | 636..700 | CDD:290150 | 19/97 (20%) | ||
TPR_1 | 636..668 | CDD:278916 | 8/44 (18%) | ||
TPR repeat | 670..694 | CDD:276809 | 7/33 (21%) | ||
TPR_11 | 714..784 | CDD:290150 | 29/172 (17%) | ||
TPR repeat | 715..743 | CDD:276809 | 10/90 (11%) | ||
TPR repeat | 748..782 | CDD:276809 | 14/42 (33%) | ||
TPR_11 | 755..819 | CDD:290150 | 22/72 (31%) | ||
TPR repeat | 787..816 | CDD:276809 | 7/28 (25%) | ||
TPR_11 | 821..887 | CDD:290150 | 14/66 (21%) | ||
TPR repeat | 822..850 | CDD:276809 | 8/28 (29%) | ||
TPR repeat | 855..885 | CDD:276809 | 4/29 (14%) | ||
TPR_11 | <874..921 | CDD:290150 | 14/57 (25%) | ||
TPR repeat | 890..918 | CDD:276809 | 8/39 (21%) | ||
odad4 | NP_956610.1 | TPR 1. /evidence=ECO:0000255 | 14..47 | 7/25 (28%) | |
TPR_11 | 16..79 | CDD:290150 | 9/57 (16%) | ||
TPR repeat | 16..42 | CDD:276809 | 6/20 (30%) | ||
TPR repeat | 47..77 | CDD:276809 | 2/29 (7%) | ||
TPR 2. /evidence=ECO:0000255 | 49..81 | 2/31 (6%) | |||
TPR_11 | 50..113 | CDD:290150 | 7/62 (11%) | ||
TPR 3. /evidence=ECO:0000255 | 82..115 | 7/32 (22%) | |||
TPR repeat | 82..110 | CDD:276809 | 4/27 (15%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 153..180 | 4/26 (15%) | |||
TPR_12 | 313..379 | CDD:290160 | 18/65 (28%) | ||
TPR 4. /evidence=ECO:0000255 | 314..347 | 11/32 (34%) | |||
TPR repeat | 316..342 | CDD:276809 | 9/25 (36%) | ||
TPR repeat | 347..383 | CDD:276809 | 9/36 (25%) | ||
TPR 5. /evidence=ECO:0000255 | 354..387 | 10/33 (30%) | |||
TPR_12 | 355..423 | CDD:290160 | 20/70 (29%) | ||
TPR 6. /evidence=ECO:0000255 | 391..424 | 10/51 (20%) | |||
TPR 7. /evidence=ECO:0000255 | 431..464 | 7/35 (20%) | |||
TPR repeat | 431..459 | CDD:276809 | 7/30 (23%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG1124 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |