DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4341 and BBS4

DIOPT Version :9

Sequence 1:NP_608558.1 Gene:CG4341 / 33276 FlyBaseID:FBgn0028481 Length:938 Species:Drosophila melanogaster
Sequence 2:NP_610636.1 Gene:BBS4 / 36167 FlyBaseID:FBgn0033578 Length:486 Species:Drosophila melanogaster


Alignment Length:374 Identity:80/374 - (21%)
Similarity:140/374 - (37%) Gaps:92/374 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   612 LSSQGRYEEAKQVLQEAIRFRPNM---ADVHFNLGILHQNQQVYPAAVECFQRAIKFRPNLAVAY 673
            ::..||..|...:  |.:|..|.|   |::.:.|.|....:: :.......:|.:....|....|
  Fly     9 INCNGRLIELPTL--EVVRPAPKMPSDANIDWLLHIYFTRRE-FTRCRRLIERELNRHLNPEYLY 70

  Fly   674 LNLGISFIALGKRQQAIEILQAGSNLDGAAVRDRTAHDQARSSAYLQLG-ALYVEQGKLQRALAI 737
            ...|:.....|...:|:..||..:.|:...:           ..|.::| .||: .|:..:||.:
  Fly    71 FVQGLIDREEGNHIEALRHLQKSAELNPRNI-----------ETYKEIGRTLYI-MGRFSQALGV 123

  Fly   738 YREA--LSSLPGLPQQREILYQRIGDVLGRL-----------QQWDEAERHHRAALELQPNQVAA 789
            :|||  .||     :|...:|..:|::|.|.           ||.|||..:...|:     |...
  Fly   124 FREAEQRSS-----RQDHEIYHYLGELLYRAATTQSQKDVASQQQDEARTYFELAV-----QSGR 178

  Fly   790 HLSYGITLA---RNSSRASEAEMWFKRALKLAPEQASVYHHYAEFLSLQSRHHESAIYHRRAAEL 851
            .|...:.||   |...:..:|....:..|.|.||.:.|   ..|...|..:.:|:...|.|.||:
  Fly   179 KLESYVRLAELYRKDKQYQKAIEILENCLHLTPENSEV---LIEISVLYLKINETQKAHDRLAEV 240

  Fly   852 --------------------APNDYTLVVAAATAMRLLDRKVDAEMW------------------ 878
                                :.||....::..:.:...:.:: ||:|                  
  Fly   241 VSIERKCSPKGLLAFGAILQSRNDIDGALSKYSQIANAEPEI-AELWNNIGLCFFKKQKFIVAIS 304

  Fly   879 -YRKAVALRPGDAHAHTNLGAILHLLGRTNHAAA--SYKAALRLQPGDA 924
             .||:|.|.|.:.:|..||..|  .:....:|:|  :..||:.|:..:|
  Fly   305 SLRKSVWLSPLNYNALYNLSLI--YIASEQYASAFHTLAAAINLRKDNA 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4341NP_608558.1 PMT_2 112..>232 CDD:304453
DUF1736 275..343 CDD:285594
TPR_11 602..667 CDD:290150 11/57 (19%)
TPR_1 602..634 CDD:278916 5/21 (24%)
TPR repeat 602..630 CDD:276809 4/17 (24%)
TPR repeat 635..665 CDD:276809 5/32 (16%)
TPR_11 636..700 CDD:290150 11/63 (17%)
TPR_1 636..668 CDD:278916 4/31 (13%)
TPR repeat 670..694 CDD:276809 4/23 (17%)
TPR_11 714..784 CDD:290150 23/83 (28%)
TPR repeat 715..743 CDD:276809 10/30 (33%)
TPR repeat 748..782 CDD:276809 11/44 (25%)
TPR_11 755..819 CDD:290150 18/77 (23%)
TPR repeat 787..816 CDD:276809 5/31 (16%)
TPR_11 821..887 CDD:290150 17/104 (16%)
TPR repeat 822..850 CDD:276809 6/27 (22%)
TPR repeat 855..885 CDD:276809 7/48 (15%)
TPR_11 <874..921 CDD:290150 17/67 (25%)
TPR repeat 890..918 CDD:276809 8/29 (28%)
BBS4NP_610636.1 TPR_12 63..127 CDD:290160 16/75 (21%)
TPR repeat 68..95 CDD:276809 6/26 (23%)
TPR_12 97..175 CDD:290160 23/99 (23%)
TPR repeat 100..130 CDD:276809 10/41 (24%)
TPR repeat 136..175 CDD:276809 10/43 (23%)
TPR repeat 179..209 CDD:276809 6/29 (21%)
TPR_19 190..254 CDD:291240 14/66 (21%)
TPR repeat 214..242 CDD:276809 8/30 (27%)
TPR repeat 249..277 CDD:276809 2/27 (7%)
TPR_11 283..348 CDD:290150 17/66 (26%)
TPR repeat 283..311 CDD:276809 5/27 (19%)
TPR repeat 316..346 CDD:276809 8/31 (26%)
TPR repeat 351..377 CDD:276809 1/1 (100%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467049
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1124
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.