DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG4341 and CG14921

DIOPT Version :9

Sequence 1:	NP_608558.1	Gene:	CG4341 / 33276	FlyBaseID:	FBgn0028481	Length:	938	Species:	Drosophila melanogaster
Sequence 2:	NP_609491.1	Gene:	CG14921 / 34547	FlyBaseID:	FBgn0032345	Length:	240	Species:	Drosophila melanogaster

Alignment Length:	98	Identity:	27/98 - (27%)
Similarity:	44/98 - (44%)	Gaps:	29/98 - (29%)

- Green bases have known domain annotations that are detailed below.

  Fly   681 IALGKRQQAI--EILQAGSNLDGAAVRDRTAHDQARSSAYLQLGALYVEQGKL--QRALAIY--- 738
            |.|.|:::.:  |:.|   .||..|:..:.          |::..|.||:.|.  ::||..|
  Fly    67 IVLVKKEKGLWPEMFQ---KLDKEALMQKR----------LEIADLIVERNKKRDEKALERYDNK 118

  Fly   739 REALSSLPGLPQQREILYQRIGDVLGRLQQWDE 771
            |.|       ..|:||  ||..|:..|::|:.|
  Fly   119 RRA-------EIQKEI--QRETDMRERVKQFQE 142

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG4341	NP_608558.1	PMT_2	112..>232	CDD:304453
		DUF1736	275..343	CDD:285594
		TPR_11	602..667	CDD:290150
		TPR_1	602..634	CDD:278916
		TPR repeat	602..630	CDD:276809
		TPR repeat	635..665	CDD:276809
		TPR_11	636..700	CDD:290150	5/20 (25%)
		TPR_1	636..668	CDD:278916
		TPR repeat	670..694	CDD:276809	4/14 (29%)
		TPR_11	714..784	CDD:290150	19/63 (30%)
		TPR repeat	715..743	CDD:276809	10/32 (31%)
		TPR repeat	748..782	CDD:276809	9/24 (38%)
		TPR_11	755..819	CDD:290150	6/17 (35%)
		TPR repeat	787..816	CDD:276809
		TPR_11	821..887	CDD:290150
		TPR repeat	822..850	CDD:276809
		TPR repeat	855..885	CDD:276809
		TPR_11	<874..921	CDD:290150
		TPR repeat	890..918	CDD:276809
CG14921	NP_609491.1	p23_DYX1C1_like	4..81	CDD:107226	4/13 (31%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E2759_KOG1124
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
	1	0.900