DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4341 and Ttc16

DIOPT Version :9

Sequence 1:NP_608558.1 Gene:CG4341 / 33276 FlyBaseID:FBgn0028481 Length:938 Species:Drosophila melanogaster
Sequence 2:NP_796358.2 Gene:Ttc16 / 338348 MGIID:2443048 Length:824 Species:Mus musculus


Alignment Length:371 Identity:76/371 - (20%)
Similarity:137/371 - (36%) Gaps:94/371 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   552 KLMSCNQRTRNILLLSFSLLLAAMSLRTLRRNADWRDEESLYRSAIAINPPKALGNLGSVLSSQG 616
            |...|.|..|:.|||.   .|.|.:...|::..| :.::||..:              |.|:.||
Mouse   233 KAKLCYQDLRSALLLD---PLHAQAKGLLQKMVD-QAKQSLQDA--------------STLAVQG 279

  Fly   617 RYEEAKQVLQEAIRFRPNMADVHFNLGILHQNQQVYPAAVECFQRAI------------KFRPNL 669
            :...|.:.:..||...|...:..|..|.|.:..|.:..|||.|.:|:            :.:..|
Mouse   280 KVHRALKCINCAIENNPLDPNFFFFRGTLRRRLQQFDHAVEDFLKAMDMVTDTQDNLVKQAQRQL 344

  Fly   670 AVAYLNLGISFIALGKRQQAIEILQAGSNLDGAAVRDRTAHDQARSSAYLQLGALYVEQGKLQRA 734
            .:.|.:..:.....|..|:.:.:|       ..|:||    :|.....|:..|..:.:.|.|..|
Mouse   345 LLTYNDFAVHCYNHGAYQEGVLLL-------NKAIRD----EQNEKGLYINRGDCFFQLGNLAFA 398

  Fly   735 LAIYREALSSLP---GLPQQREILYQRIGDVLGRLQQWDEAERHHRAALELQP------------ 784
            .|.|::||:..|   |...:..:|.:::|....:.:|:..||.|...|:...|            
Mouse   399 EADYKQALALSPLDEGANLRMGVLQEKLGFCQQKHRQFQTAEEHFSEAIRHSPQKPQYYLHRAKC 463

  Fly   785 -----NQVAAHLSYGITLARNSSRASEAEMWFKRALKLAPEQASVYHHYAEFLSLQSRHHESAIY 844
                 |.:.|.|.....|..|..               .|:.|:|.:.....:::::      :.
Mouse   464 RQFLQNTLGARLDVATVLLLNPE---------------YPKMAAVMNTLFPSMTVEN------VL 507

  Fly   845 HRRAAELAPNDYTLVV---------AAATAMRLLDRK---VDAEMW 878
            ..:.||||....:.::         .:....|||:|:   |..::|
Mouse   508 KSQVAELAKLQLSRMIENGPKNIYPQSTVVQRLLERRKAQVLVKLW 553

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4341NP_608558.1 PMT_2 112..>232 CDD:304453
DUF1736 275..343 CDD:285594
TPR_11 602..667 CDD:290150 17/76 (22%)
TPR_1 602..634 CDD:278916 7/31 (23%)
TPR repeat 602..630 CDD:276809 6/27 (22%)
TPR repeat 635..665 CDD:276809 9/41 (22%)
TPR_11 636..700 CDD:290150 14/75 (19%)
TPR_1 636..668 CDD:278916 9/43 (21%)
TPR repeat 670..694 CDD:276809 3/23 (13%)
TPR_11 714..784 CDD:290150 18/72 (25%)
TPR repeat 715..743 CDD:276809 8/27 (30%)
TPR repeat 748..782 CDD:276809 7/33 (21%)
TPR_11 755..819 CDD:290150 13/80 (16%)
TPR repeat 787..816 CDD:276809 4/28 (14%)
TPR_11 821..887 CDD:290150 12/70 (17%)
TPR repeat 822..850 CDD:276809 2/27 (7%)
TPR repeat 855..885 CDD:276809 6/36 (17%)
TPR_11 <874..921 CDD:290150 1/5 (20%)
TPR repeat 890..918 CDD:276809
Ttc16NP_796358.2 TPR repeat 75..103 CDD:276809
TPR 87..381 CDD:223533 39/176 (22%)
TPR repeat 108..138 CDD:276809
TPR repeat 143..170 CDD:276809
TPR repeat 183..213 CDD:276809
TPR repeat 218..245 CDD:276809 4/11 (36%)
TPR repeat 299..327 CDD:276809 9/27 (33%)
TPR repeat 347..373 CDD:276809 5/32 (16%)
TPR repeat 378..408 CDD:276809 9/29 (31%)
TPR_11 381..451 CDD:290150 18/69 (26%)
TPR_1 382..410 CDD:278916 9/27 (33%)
TPR repeat 413..448 CDD:276809 8/34 (24%)
TPR_11 426..485 CDD:290150 11/58 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1124
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.