Sequence 1: | NP_608558.1 | Gene: | CG4341 / 33276 | FlyBaseID: | FBgn0028481 | Length: | 938 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_955932.2 | Gene: | tomm34 / 323361 | ZFINID: | ZDB-GENE-030131-2081 | Length: | 305 | Species: | Danio rerio |
Alignment Length: | 329 | Identity: | 62/329 - (18%) |
---|---|---|---|
Similarity: | 106/329 - (32%) | Gaps: | 126/329 - (38%) |
- Green bases have known domain annotations that are detailed below.
Fly 581 RRNADWRDEESLYRSAIAINPPKALGNLGSVLSSQGRYEEAKQVLQEAI-RFRPNMADVHFNLGI 644
Fly 645 LHQNQQVYPAAV--------ECFQ---RAIKFRPNLAVAYLNLGISFIALGKRQQAI----EILQ 694
Fly 695 AGSNLDGAAVRDRTAHDQARSSAYLQLGALYVEQGKLQRALA-----IYREALSSLPGLP----- 749
Fly 750 ------------QQREIL-----------------YQRIGDVLGRLQQWDEAERHHRAALELQPN 785
Fly 786 QVAAH----LSY-GITLARNSSRASEAEMWFKRALKLAPEQASVYHHYAEFLSLQSRHHESAIYH 845
Fly 846 RRAA 849 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG4341 | NP_608558.1 | PMT_2 | 112..>232 | CDD:304453 | |
DUF1736 | 275..343 | CDD:285594 | |||
TPR_11 | 602..667 | CDD:290150 | 17/76 (22%) | ||
TPR_1 | 602..634 | CDD:278916 | 8/32 (25%) | ||
TPR repeat | 602..630 | CDD:276809 | 8/28 (29%) | ||
TPR repeat | 635..665 | CDD:276809 | 9/40 (23%) | ||
TPR_11 | 636..700 | CDD:290150 | 20/78 (26%) | ||
TPR_1 | 636..668 | CDD:278916 | 9/42 (21%) | ||
TPR repeat | 670..694 | CDD:276809 | 7/27 (26%) | ||
TPR_11 | 714..784 | CDD:290150 | 13/108 (12%) | ||
TPR repeat | 715..743 | CDD:276809 | 4/32 (13%) | ||
TPR repeat | 748..782 | CDD:276809 | 7/67 (10%) | ||
TPR_11 | 755..819 | CDD:290150 | 13/85 (15%) | ||
TPR repeat | 787..816 | CDD:276809 | 6/33 (18%) | ||
TPR_11 | 821..887 | CDD:290150 | 5/29 (17%) | ||
TPR repeat | 822..850 | CDD:276809 | 5/28 (18%) | ||
TPR repeat | 855..885 | CDD:276809 | |||
TPR_11 | <874..921 | CDD:290150 | |||
TPR repeat | 890..918 | CDD:276809 | |||
tomm34 | NP_955932.2 | TPR_11 | 13..83 | CDD:290150 | 17/73 (23%) |
TPR repeat | 13..38 | CDD:276809 | 7/24 (29%) | ||
TPR repeat | 43..81 | CDD:276809 | 9/41 (22%) | ||
TPR_11 | 54..116 | CDD:290150 | 16/65 (25%) | ||
TPR repeat | 86..114 | CDD:276809 | 7/27 (26%) | ||
TPR_11 | 191..254 | CDD:290150 | 13/70 (19%) | ||
TPR repeat | 191..218 | CDD:276809 | 3/26 (12%) | ||
TPR repeat | 223..253 | CDD:276809 | 7/35 (20%) | ||
TPR_11 | 226..289 | CDD:290150 | 12/66 (18%) | ||
TPR | 226..257 | CDD:197478 | 7/38 (18%) | ||
TPR_1 | 258..291 | CDD:278916 | 4/26 (15%) | ||
TPR repeat | 258..286 | CDD:276809 | 4/26 (15%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG1124 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |