DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4341 and tomm34

DIOPT Version :9

Sequence 1:NP_608558.1 Gene:CG4341 / 33276 FlyBaseID:FBgn0028481 Length:938 Species:Drosophila melanogaster
Sequence 2:NP_955932.2 Gene:tomm34 / 323361 ZFINID:ZDB-GENE-030131-2081 Length:305 Species:Danio rerio


Alignment Length:329 Identity:62/329 - (18%)
Similarity:106/329 - (32%) Gaps:126/329 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   581 RRNADWRDEESLYRSAIAINPPKALGNLGSVLSSQGRYEEAKQVLQEAI-RFRPNMADVHFNLGI 644
            ||...|.|                |...|:.....|:|.||..:..:|| :...:......:|||
Zfish     5 RRTQSWTD----------------LKQAGNECFKAGQYGEAVTLYSQAIQQLEKSGQKKTEDLGI 53

  Fly   645 LHQNQQVYPAAV--------ECFQ---RAIKFRPNLAVAYLNLGISFIALGKRQQAI----EILQ 694
            |:.|:    ||.        ||.:   .::...|....|.|....:|.||.:.:||.    .:||
Zfish    54 LYSNR----AASYLKDGNCNECIKDCTASLDLVPFGFKALLRRAAAFEALERYRQAYVDYKTVLQ 114

  Fly   695 AGSNLDGAAVRDRTAHDQARSSAYLQLGALYVEQGKLQRALA-----IYREALSSLPGLP----- 749
            ...|:.       .|||..               .::.:||.     .:||.|..:|.:|     
Zfish   115 IDWNIP-------AAHDGV---------------NRMTKALTEMDGPSWREKLPPIPTVPMSVKE 157

  Fly   750 ------------QQREIL-----------------YQRIGDVLGRLQQWDEAERHHRAALELQPN 785
                        ||..::                 .:..|:.|.:..:..:|...:..:|...|.
Zfish   158 KLGQAASPASSSQQNNVIDDKKKAPGPDAVKKGRTLKEEGNALVKKGEHKKAMEKYTQSLAQDPT 222

  Fly   786 QVAAH----LSY-GITLARNSSRASEAEMWFKRALKLAPEQASVYHHYAEFLSLQSRHHESAIYH 845
            :|..:    |.| .:.:.:::.|..|      .||:|  :.|::                .|:|.
Zfish   223 EVTTYTNRALCYLALKMYKDAIRDCE------EALRL--DSANI----------------KALYR 263

  Fly   846 RRAA 849
            |..|
Zfish   264 RAQA 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4341NP_608558.1 PMT_2 112..>232 CDD:304453
DUF1736 275..343 CDD:285594
TPR_11 602..667 CDD:290150 17/76 (22%)
TPR_1 602..634 CDD:278916 8/32 (25%)
TPR repeat 602..630 CDD:276809 8/28 (29%)
TPR repeat 635..665 CDD:276809 9/40 (23%)
TPR_11 636..700 CDD:290150 20/78 (26%)
TPR_1 636..668 CDD:278916 9/42 (21%)
TPR repeat 670..694 CDD:276809 7/27 (26%)
TPR_11 714..784 CDD:290150 13/108 (12%)
TPR repeat 715..743 CDD:276809 4/32 (13%)
TPR repeat 748..782 CDD:276809 7/67 (10%)
TPR_11 755..819 CDD:290150 13/85 (15%)
TPR repeat 787..816 CDD:276809 6/33 (18%)
TPR_11 821..887 CDD:290150 5/29 (17%)
TPR repeat 822..850 CDD:276809 5/28 (18%)
TPR repeat 855..885 CDD:276809
TPR_11 <874..921 CDD:290150
TPR repeat 890..918 CDD:276809
tomm34NP_955932.2 TPR_11 13..83 CDD:290150 17/73 (23%)
TPR repeat 13..38 CDD:276809 7/24 (29%)
TPR repeat 43..81 CDD:276809 9/41 (22%)
TPR_11 54..116 CDD:290150 16/65 (25%)
TPR repeat 86..114 CDD:276809 7/27 (26%)
TPR_11 191..254 CDD:290150 13/70 (19%)
TPR repeat 191..218 CDD:276809 3/26 (12%)
TPR repeat 223..253 CDD:276809 7/35 (20%)
TPR_11 226..289 CDD:290150 12/66 (18%)
TPR 226..257 CDD:197478 7/38 (18%)
TPR_1 258..291 CDD:278916 4/26 (15%)
TPR repeat 258..286 CDD:276809 4/26 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1124
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.