Sequence 1: | NP_608558.1 | Gene: | CG4341 / 33276 | FlyBaseID: | FBgn0028481 | Length: | 938 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001012116.1 | Gene: | Spag1 / 315033 | RGDID: | 1310702 | Length: | 893 | Species: | Rattus norvegicus |
Alignment Length: | 303 | Identity: | 64/303 - (21%) |
---|---|---|---|
Similarity: | 108/303 - (35%) | Gaps: | 88/303 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 598 AINPPKALGNLGSVLSSQGRYEEAKQVLQEAI-RFRPNMADVHFNLGILHQNQQVYPAAV----- 656
Fly 657 ---ECFQ---RAIKFRP-------NLAVAYLNLG------ISFIALGKRQQAIEILQAGSN---- 698
Fly 699 ----LDGAAVRDR----------------------------------TAHDQARSSAYLQLGALY 725
Fly 726 VEQGKLQRALAIYREAL---SSLPGLPQQREILYQRIGDVLGRLQQWDEAERHHRAALELQPNQV 787
Fly 788 AAHLSYGITLAR---NSSRASEAEMWFKRALKLAPEQASVYHH 827 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG4341 | NP_608558.1 | PMT_2 | 112..>232 | CDD:304453 | |
DUF1736 | 275..343 | CDD:285594 | |||
TPR_11 | 602..667 | CDD:290150 | 20/76 (26%) | ||
TPR_1 | 602..634 | CDD:278916 | 9/32 (28%) | ||
TPR repeat | 602..630 | CDD:276809 | 9/28 (32%) | ||
TPR repeat | 635..665 | CDD:276809 | 10/40 (25%) | ||
TPR_11 | 636..700 | CDD:290150 | 19/95 (20%) | ||
TPR_1 | 636..668 | CDD:278916 | 11/49 (22%) | ||
TPR repeat | 670..694 | CDD:276809 | 7/29 (24%) | ||
TPR_11 | 714..784 | CDD:290150 | 16/72 (22%) | ||
TPR repeat | 715..743 | CDD:276809 | 7/30 (23%) | ||
TPR repeat | 748..782 | CDD:276809 | 8/33 (24%) | ||
TPR_11 | 755..819 | CDD:290150 | 16/66 (24%) | ||
TPR repeat | 787..816 | CDD:276809 | 8/31 (26%) | ||
TPR_11 | 821..887 | CDD:290150 | 1/7 (14%) | ||
TPR repeat | 822..850 | CDD:276809 | 1/6 (17%) | ||
TPR repeat | 855..885 | CDD:276809 | |||
TPR_11 | <874..921 | CDD:290150 | |||
TPR repeat | 890..918 | CDD:276809 | |||
Spag1 | NP_001012116.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 112..155 | ||
3a0801s09 | 141..>303 | CDD:273380 | |||
TPR 1 | 213..246 | ||||
TPR repeat | 217..241 | CDD:276809 | |||
TPR repeat | 246..275 | CDD:276809 | |||
TPR 2 | 247..279 | ||||
TPR 3 | 280..313 | ||||
TPR repeat | 280..308 | CDD:276809 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 324..344 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 349..368 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 373..437 | 3/11 (27%) | |||
TPR 4 | 429..463 | 10/33 (30%) | |||
3a0801s09 | <432..>569 | CDD:273380 | 33/140 (24%) | ||
TPR repeat | 432..458 | CDD:276809 | 8/25 (32%) | ||
TPR repeat | 466..500 | CDD:276809 | 10/37 (27%) | ||
TPR 5 | 471..504 | 10/36 (28%) | |||
TPR repeat | 505..533 | CDD:276809 | 5/27 (19%) | ||
TPR 6 | 506..538 | 6/31 (19%) | |||
3a0801s09 | 569..>695 | CDD:273380 | 25/134 (19%) | ||
TPR 7 | 605..638 | 8/32 (25%) | |||
TPR repeat | 606..633 | CDD:276809 | 6/26 (23%) | ||
TPR repeat | 638..668 | CDD:276809 | 8/36 (22%) | ||
TPR 8 | 639..672 | 8/39 (21%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 704..756 | 2/9 (22%) | |||
RPAP3_C | 769..858 | CDD:404718 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG1124 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |