DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tmtc2 and Tomm34

DIOPT Version :10

Sequence 1:NP_608558.1 Gene:Tmtc2 / 33276 FlyBaseID:FBgn0028481 Length:938 Species:Drosophila melanogaster
Sequence 2:NP_001037709.1 Gene:Tomm34 / 311621 RGDID:1309029 Length:309 Species:Rattus norvegicus


Alignment Length:268 Identity:59/268 - (22%)
Similarity:102/268 - (38%) Gaps:56/268 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   557 NQRTRNILLLSFSLLL-AAMSLRTLRRNADWRDEESLY--------------------RSAIAIN 600
            ||..||......|.|. .|:.|...|.:||..:|..||                    .||:|:.
  Rat    17 NQNFRNGQYGEASALYERALRLLQARGSADPEEESVLYSNRAACYLKDGNCTDCIKDCTSALALV 81

  Fly   601 PPKALGNLGSVLSSQGRYEEAKQVLQEAIRFRPNMADVHFNLGILHQNQQVYPA--AVECFQRAI 663
            |    .::..:|.....||..::.         ::|.|.:.. :|..:..|..|  .:....||:
  Rat    82 P----FSIKPLLRRASAYEALEKY---------SLAYVDYKT-VLQIDNSVASALEGINRITRAL 132

  Fly   664 --KFRPNLAVAYLNLGISFIALGKRQQAI------EILQAGSNLDGAAVRDR--TAHDQARSSAY 718
              ...|...:....:.:..::..||..::      |..::.|. :..|.::|  :|.|..|:...
  Rat   133 MDSLGPEWRLKLPPIPVVPVSAQKRWSSLPSENHKETAKSKSK-ETTATKNRVPSAGDVERARVL 196

  Fly   719 LQLGALYVEQGKLQRALAIYREAL--SSLPGLPQQREILYQRIGDVLGRLQQWDEAERHHRAALE 781
            .:.|...|::|..::|:..|.|:|  |||.........|...:      |:|:.|||:....||:
  Rat   197 KEEGNELVKKGNHKKAIEKYSESLLFSSLESATYSNRALCHLV------LKQYKEAEKDCTEALK 255

  Fly   782 LQPNQVAA 789
            |....|.|
  Rat   256 LDGKNVKA 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tmtc2NP_608558.1 TMTC_DUF1736 270..343 CDD:462468
TPR 597..852 CDD:440225 43/207 (21%)
TPR repeat 602..630 CDD:276809 3/27 (11%)
TPR repeat 635..665 CDD:276809 7/33 (21%)
TPR repeat 670..694 CDD:276809 3/29 (10%)
TPR repeat 715..743 CDD:276809 7/29 (24%)
TPR repeat 748..782 CDD:276809 8/33 (24%)
TPR 780..>933 CDD:440225 4/10 (40%)
TPR repeat 787..816 CDD:276809 2/3 (67%)
TPR repeat 822..850 CDD:276809
TPR repeat 855..885 CDD:276809
TPR repeat 890..918 CDD:276809
Tomm34NP_001037709.1 TPR 1 9..42 8/24 (33%)
TPR repeat 9..37 CDD:276809 7/19 (37%)
3a0801s09 <11..>294 CDD:273380 59/268 (22%)
TPR repeat 50..80 CDD:276809 5/29 (17%)
TPR 2 51..84 6/36 (17%)
TPR repeat 85..113 CDD:276809 5/37 (14%)
TPR 3 86..118 6/41 (15%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 158..187 4/29 (14%)
TPR 4 193..226 9/32 (28%)
TPR repeat 193..221 CDD:276809 6/27 (22%)
TPR repeat 226..256 CDD:276809 8/35 (23%)
TPR 5 227..260 9/38 (24%)
TPR repeat 261..289 CDD:276809 2/3 (67%)
TPR 6 262..294 1/2 (50%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.